Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.02
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession Q969H9 Q08AK1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPEAHMQPAKLQTSLPTTDHGSKKPVSCYLPPLSNAHPMCIEVQNAQNCSSAAATLEPSIISDTCFYKPI      1 - 70
TKDQLSSRSELNTVRLKCLNSLRGWKILNQLSLT                                         71 - 104
//

Text Mined References (7)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20648054 2010 Hemizygous deletion of COL3A1, COL5A2, and MSTN causes a complex phenotype with aortic dissection: a lesson for and from true haploinsufficiency.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11776380 2001 Characterization of a familial RCC-associated t(2;3)(q33;q21) chromosome translocation.
11587072 2001 The DIRC1 gene at chromosome 2q33 spans a familial RCC-associated t(2;3)(q33;q21) chromosome translocation.