Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.02
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
inflammatory breast cancer 286 8.6e-03
Disease Target Count Z-score Confidence
Loeys-Dietz syndrome 23 4.187 2.1
Ehlers-Danlos syndrome 43 3.573 1.8

AA Sequence

MPEAHMQPAKLQTSLPTTDHGSKKPVSCYLPPLSNAHPMCIEVQNAQNCSSAAATLEPSIISDTCFYKPI      1 - 70
TKDQLSSRSELNTVRLKCLNSLRGWKILNQLSLT                                         71 - 104
//

Text Mined References (7)

PMID Year Title