Property Summary

NCBI Gene PubMed Count 10
PubMed Score 192.12
PubTator Score 71.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Keloid 34
Disease Target Count P-value
ovarian cancer 8492 4.62305064757956E-5
psoriasis 6685 5.70727829814111E-5
Multiple myeloma 1328 1.48147303956599E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00185059111829318
glioblastoma 5572 0.00535390546538759

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 2.044 0.000
psoriasis 1.500 0.000
glioblastoma 1.200 0.005
pancreatic ductal adenocarcinoma liver m... -2.194 0.002
ovarian cancer 1.700 0.000

Synonym

Accession Q969H8 D6W628 O75256 O75272 Q9BTK7 Q9NP69 MYDGF
Symbols IL25
IL27
SF20
IL27w
C19orf10
R33729_1
EUROIMAGE1875335

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (4)

PMID Text
25581518 Bone marrow-derived monocytes and macrophages produce this protein endogenously to protect and repair the heart after myocardial infarction.
21128247 Taken together, these data suggest that c19orf10 might be one of the growth factors and potential molecular targets activated in HCC.
17362502 we identified a novel protein, c19orf10 (chromosome 19 open reading frame 10), produced by fibroblast-like synoviocytes
14641539 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAPSGGWNGVGASLWAALLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQ      1 - 70
GGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEE     71 - 140
FEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL                                         141 - 173
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25581518 2015 Myeloid-derived growth factor (C19orf10) mediates cardiac repair following myocardial infarction.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
21128247 2011 Identification of a secretory protein c19orf10 activated in hepatocellular carcinoma.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
17362502 2007 The identification and characterization of a novel protein, c19orf10, in the synovium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...