Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
R01 Count 5
Funding $399,201.25
PubMed Score 19.14
PubTator Score 11.04

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q93098 O00771 Q5VX55 Q8WYK9
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
20972907 WNT8b and SHH mutations and abnormal expressions are present in the peripheral blood of children with sporadic Hirschsprung disease.
20972907 Observational study of gene-disease association. (HuGE Navigator)
17390031 WNT8B expression in hepatocyte progenitors derived from human ES cells is due to POU5F1 (OCT3/OCT4) and GATA3, and WNT8B expression in diffuse-type gastric cancer is due to POU5F1 and GATA6
16385451 Observational study of gene-disease association. (HuGE Navigator)
11956596 Expression and regulation of WNT8B mRNA in human tumor cell lines
11788899 significantly up-regulated in gastric cancer cell lines KATO-III (signet-ring cell carcinoma) and MKN45 (poorly differentiated adenocarcinoma), and also in 5 out of 10 cases of primary gastric cancer

AA Sequence

MFLSKPSVYICLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERAL      1 - 70
QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGE     71 - 140
AISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKE    141 - 210
KYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALG    211 - 280
RWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRK    281 - 350
P//

Text Mined References (13)

PMID Year Title
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
20972907 2010 [Mutation and expression of WNT8b gene and SHH gene in Hirschsprung disease].
17390031 2007 Conserved POU/OCT- and GATA-binding sites in 5'-flanking promoter region of mammalian WNT8B orthologs.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
11956596 2002 Expression and regulation of WNT8A and WNT8B mRNAs in human tumor cell lines: up-regulation of WNT8B mRNA by beta-estradiol in MCF-7 cells, and down-regulation of WNT8A and WNT8B mRNAs by retinoic acid in NT2 cells.
11788899 2002 Up-regulation of WNT8B mRNA in human gastric cancer.
9536085 1998 A novel mammalian wnt gene, WNT8B, shows brain-restricted expression in early development, with sharply delimited expression boundaries in the developing forebrain.
More...