Property Summary

NCBI Gene PubMed Count 33
PubMed Score 53.42
PubTator Score 41.74

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 4.76347626636363E-35
ovarian cancer 8492 5.58554836841501E-18
cystic fibrosis 1670 7.25373594698403E-8
malignant mesothelioma 3163 3.14571662612201E-7
medulloblastoma, large-cell 6234 0.00103180052565205
oligodendroglioma 2849 0.00316860046145446
pilocytic astrocytoma 3086 0.00333601287432558
astrocytic glioma 2241 0.00441199727806516
ependymoma 2514 0.0126153616586079
chronic rhinosinusitis 512 0.0192889189629722
acute myeloid leukemia 785 0.0291690195668011


  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
astrocytic glioma -1.700 0.004
ependymoma -1.500 0.013
oligodendroglioma -1.900 0.003
cystic fibrosis -4.747 0.000
medulloblastoma, large-cell -1.100 0.001
pilocytic astrocytoma 1.100 0.003
acute myeloid leukemia -1.300 0.029
psoriasis -1.800 0.000
ovarian cancer -5.800 0.000
chronic rhinosinusitis -1.115 0.019


Accession Q93097 O14903 Q5TEH9 Q5TEI2 Q9HDC1 Q9HDC2
Symbols WNT13


PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (18)

26548512 the present study detected abnormal upregulation in the levels of Wnt2b and Wnt7b, and hypothesized that the alterations may be due to the ectopic opening of chromatin structure.
25356045 ACSL5 mediates antiproliferative activities via Wnt2B palmitoylation with diminished Wnt activity. The molecular pathway is probably relevant for intestinal homeostasis, overwhelmed by other pathways in carcinogenesis.
25297925 Results showed that miR-185-3p contributs to radioresistance of nasopharyngeal carcinoma via modulation of WNT2B expression.
25120849 these results indicate that the high-expression levels of Gli1 and Wnt2B might play a pivotal role during tumorigenesis of pancreatic cancer
23785285 secretion of WNT2B and WNT9B and stabilization of beta-catenin (CTNNB1) upon virus infection negatively regulate expression of representative inducible genes IFNB1, IFIT1 and TNF in a CTNNB1-dependent effector mechanism
22635028 High Wnt2B overexpression is associated with ovarian cancer metastasis and drug resistance.
20844743 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

RVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT                                 351 - 391

Text Mined References (36)

PMID Year Title
26548512 2016 Abnormal epigenetic regulation of the gene expression levels of Wnt2b and Wnt7b: Implications for neural tube defects.
25356045 2014 Modulating effects of acyl-CoA synthetase 5-derived mitochondrial Wnt2B palmitoylation on intestinal Wnt activity.
25297925 2014 miR-185-3p regulates nasopharyngeal carcinoma radioresistance by targeting WNT2B in vitro.
25120849 2014 Expression of Gli1 and Wnt2B correlates with progression and clinical outcome of pancreatic cancer.
23785285 2013 Genome-wide RNAi screen reveals a new role of a WNT/CTNNB1 signaling pathway as negative regulator of virus-induced innate immune responses.
23583221 2013 MicroRNA-324-3p regulates nasopharyngeal carcinoma radioresistance by directly targeting WNT2B.
22635028 2012 Silencing Wnt2B by siRNA interference inhibits metastasis and enhances chemotherapy sensitivity in ovarian cancer.
20844743 2010 Single nucleotide polymorphisms in the Wnt and BMP pathways and colorectal cancer risk in a Spanish cohort.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.