Property Summary

NCBI Gene PubMed Count 35
PubMed Score 58.02
PubTator Score 41.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 3.053 1.5

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia -1.300 2.9e-02
astrocytic glioma -1.700 4.4e-03
Astrocytoma, Pilocytic 1.200 3.5e-03
chronic rhinosinusitis -1.115 1.9e-02
cystic fibrosis -3.255 1.8e-07
ependymoma -1.500 1.3e-02
malignant mesothelioma -1.900 3.1e-07
medulloblastoma, large-cell -1.100 1.0e-03
oligodendroglioma -1.900 3.2e-03
ovarian cancer -4.400 1.4e-14
psoriasis -1.400 1.2e-25

 GO Function (1)

Gene RIF (20)

AA Sequence

MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLTLPARVDTSWWYIGALGARV      1 - 70
ICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAA     71 - 140
FVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRL    141 - 210
KDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQD    211 - 280
GANFTAARQGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVT    281 - 350
RVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT                                 351 - 391
//

Text Mined References (38)

PMID Year Title