Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
R01 Count 4
Funding $85,804.15
PubMed Score 10.01
PubTator Score 6.15

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
25075772 Ribonucleases 6 is an antimicrobial peptide with activity against uropathogens and participates in the maintenance of urinary tract sterility.
24162774 HIV-1 gp120 downregulates the expression of ribonuclease K6 (RNASE6) in human B cells
23383108 HIV-1 gp120 downregulates the expression of ribonuclease K6 (RNASE6) in human B cells

AA Sequence

MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDS      1 - 70
FQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYK     71 - 140
LVPVHLDSIL                                                                141 - 150
//

Text Mined References (9)

PMID Year Title
25075772 2015 Ribonucleases 6 and 7 have antimicrobial function in the human and murine urinary tract.
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15676279 2005 The ribonuclease A superfamily of mammals and birds: identifying new members and tracing evolutionary histories.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9647635 1998 Ribonuclease k6: chromosomal mapping and divergent rates of evolution within the RNase A gene superfamily.
8836175 1996 Molecular cloning and characterization of a novel human ribonuclease (RNase k6): increasing diversity in the enlarging ribonuclease gene family.