Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.01
PubTator Score 6.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
periodontitis 269 2.90256297109657E-24
lung carcinoma 2844 3.87841055541362E-10
ovarian cancer 8492 7.89041175890735E-7
pilocytic astrocytoma 3086 7.07107631601911E-6
glioblastoma 5572 7.75151714934031E-5
tuberculosis 1563 7.87570211730699E-5
invasive ductal carcinoma 2950 1.11875611535332E-4
primary Sjogren syndrome 789 2.28938419799237E-4
psoriasis 6685 2.37400072799191E-4
cutaneous lupus erythematosus 1056 2.4852966460354E-4
lung cancer 4473 2.71959694990724E-4
ulcerative colitis 2087 3.6418526758371E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00106156073674194
medulloblastoma, large-cell 6234 0.001122829530941
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00116671876422051
head and neck cancer and chronic obstructive pulmonary disease 237 0.001526917685465
adrenocortical carcinoma 1427 0.00216494992450537
interstitial cystitis 2299 0.00628881051521113
group 4 medulloblastoma 1875 0.00822985148664501
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0215355914074958
Pick disease 1893 0.0269796667590798
Alzheimer's disease 644 0.0375739595686292
osteosarcoma 7933 0.0414174706100391
astrocytoma 1493 0.0481704409164848

Expression

Synonym

Accession Q93091 RNase K6
Symbols RAD1
RNS6
RNasek6

Gene

PDB

4X09  

  Ortholog (6)

Gene RIF (3)

PMID Text
25075772 Ribonucleases 6 is an antimicrobial peptide with activity against uropathogens and participates in the maintenance of urinary tract sterility.
24162774 HIV-1 gp120 downregulates the expression of ribonuclease K6 (RNASE6) in human B cells
23383108 HIV-1 gp120 downregulates the expression of ribonuclease K6 (RNASE6) in human B cells

AA Sequence

MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDS      1 - 70
FQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYK     71 - 140
LVPVHLDSIL                                                                141 - 150
//

Text Mined References (9)

PMID Year Title
25075772 2015 Ribonucleases 6 and 7 have antimicrobial function in the human and murine urinary tract.
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15676279 2005 The ribonuclease A superfamily of mammals and birds: identifying new members and tracing evolutionary histories.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9647635 1998 Ribonuclease k6: chromosomal mapping and divergent rates of evolution within the RNase A gene superfamily.
8836175 1996 Molecular cloning and characterization of a novel human ribonuclease (RNase k6): increasing diversity in the enlarging ribonuclease gene family.