Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.01
PubTator Score 6.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -1.879 2.2e-03
Alzheimer's disease 1.500 3.8e-02
astrocytoma 2.000 4.8e-02
Astrocytoma, Pilocytic 1.600 7.5e-06
cutaneous lupus erythematosus 2.200 2.5e-04
glioblastoma 3.100 7.8e-05
group 4 medulloblastoma -1.200 8.2e-03
head and neck cancer and chronic obstruc... 1.100 1.5e-03
interstitial cystitis 1.600 6.3e-03
intraductal papillary-mucinous adenoma (... -1.700 1.2e-03
intraductal papillary-mucinous carcinoma... -1.900 1.1e-03
intraductal papillary-mucinous neoplasm ... -1.600 2.2e-02
invasive ductal carcinoma 1.834 1.1e-04
lung cancer -1.600 2.7e-04
lung carcinoma -1.400 3.9e-10
medulloblastoma, large-cell -1.300 1.1e-03
osteosarcoma -1.322 4.1e-02
ovarian cancer -2.100 7.9e-07
periodontitis 1.100 2.9e-24
Pick disease 1.500 2.7e-02
primary Sjogren syndrome 1.900 2.3e-04
psoriasis -2.100 2.4e-04
tuberculosis 1.500 7.9e-05
ulcerative colitis 1.900 3.6e-04

Gene RIF (4)

AA Sequence

MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDS      1 - 70
FQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYK     71 - 140
LVPVHLDSIL                                                                141 - 150
//

Text Mined References (11)

PMID Year Title