Property Summary

NCBI Gene PubMed Count 7
PubMed Score 40.10
PubTator Score 2.10

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (1)

PMID Text
15747776 Eight MT genes were up-regulated after treatment of T-ALL cells with 0.15 and 1.5 microg/mL of metal ores. Heavy metal binding activity.

AA Sequence

MDPNCSCATGGSCSCASSCKCKECKCTSCKKSCCSCCPMGCAKCAQGCVCKGASEKCSCCA               1 - 61
//

Text Mined References (7)

PMID Year Title
16395595 2006 Human-specific nonsense mutations identified by genome sequence comparisons.
15747776 2003 Dose-dependent transcriptome changes by metal ores on a human acute lymphoblastic leukemia cell line.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9074634 1997 Human metallothionein gene MT1L mRNA is present in several human tissues but is unlikely to produce a metallothionein protein.
8766831 1996 Cloning and sequencing a novel metallothionein I isoform expressed in human reticulocytes.
8049263 1994 Characterisation of six additional human metallothionein genes.
2286373 1990 Human metallothionein genes: structure of the functional locus at 16q13.