Property Summary

NCBI Gene PubMed Count 7
PubMed Score 41.59
PubTator Score 2.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (1)

AA Sequence

MDPNCSCATGGSCSCASSCKCKECKCTSCKKSCCSCCPMGCAKCAQGCVCKGASEKCSCCA               1 - 61
//

Text Mined References (7)

PMID Year Title