Property Summary

NCBI Gene PubMed Count 23
PubMed Score 131.85
PubTator Score 24.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 1.343 6.6e-03
active ulcerative colitis 2.983 3.7e-04
adrenocortical carcinoma -1.147 1.2e-02
atypical teratoid / rhabdoid tumor 1.300 2.3e-02
Breast cancer -1.100 1.4e-03
colon cancer -1.800 2.5e-02
dermatomyositis 1.200 3.3e-02
ductal carcinoma in situ -1.300 2.7e-03
glioblastoma 1.200 1.4e-02
group 4 medulloblastoma -1.500 5.1e-03
intraductal papillary-mucinous adenoma (... -2.000 5.4e-04
intraductal papillary-mucinous carcinoma... -1.900 1.4e-02
invasive ductal carcinoma -1.043 1.4e-03
lung cancer -1.300 4.7e-02
lung carcinoma -1.800 4.4e-19
malignant mesothelioma -3.800 6.1e-08
non primary Sjogren syndrome sicca 1.300 2.7e-02
non-small cell lung cancer -1.309 1.7e-16
ovarian cancer -2.900 2.2e-09
Pick disease 1.200 1.3e-02
pituitary cancer -1.500 2.6e-07
posterior fossa group A ependymoma 1.100 5.6e-09
primitive neuroectodermal tumor 1.200 1.0e-02
psoriasis -1.100 1.2e-06
spina bifida -2.475 3.4e-02
subependymal giant cell astrocytoma 2.945 1.6e-02
urothelial carcinoma -1.100 6.3e-05

Protein-protein Interaction (2)

Gene RIF (7)

AA Sequence

MNNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDS      1 - 70
RSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGTPNPSTPLPNTVPQFIAREPYELTVPAL     71 - 140
YPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWLPPSEATSQGWKSRQFC                  141 - 196
//

Text Mined References (25)

PMID Year Title