Property Summary

NCBI Gene PubMed Count 18
Grant Count 23
R01 Count 14
Funding $6,477,760.25
PubMed Score 113.99
PubTator Score 24.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
25281386 RBPMS1 is a critical repressor of AP-1 signaling and RBPMS1 activation may be a useful strategy for cancer treatment.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDS      1 - 70
RSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGTPNPSTPLPNTVPQFIAREPYELTVPAL     71 - 140
YPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWLPPSEATSQGWKSRQFC                  141 - 196
//

Text Mined References (20)

PMID Year Title
27365365 2016 Diverse alternative back-splicing and alternative splicing landscape of circular RNAs.
26347403 2016 Structural basis underlying CAC RNA recognition by the RRM domain of dimeric RNA-binding protein RBPMS.
25416956 2014 A proteome-scale map of the human interactome network.
25281386 2015 The RNA-binding protein RBPMS1 represses AP-1 signaling and regulates breast cancer cell proliferation and migration.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22174390 2012 Heritability of submaximal exercise heart rate response to exercise training is accounted for by nine SNPs.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...