Property Summary

NCBI Gene PubMed Count 18
PubMed Score 113.99
PubTator Score 24.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 1.87636208538784E-27
lung carcinoma 2844 4.43128978075362E-19
non-small cell lung cancer 2798 1.66296268387165E-16
posterior fossa group A ependymoma 1511 5.61816109044423E-9
ovarian cancer 8492 1.47167652538553E-8
malignant mesothelioma 3163 6.09657696302241E-8
pituitary cancer 1972 4.20468525861798E-7
lung cancer 4473 4.54317465176156E-6
urothelial carcinoma 318 6.28767302505526E-5
active ulcerative colitis 477 6.42502393607929E-5
active Crohn's disease 918 1.69972833084573E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.40531391003155E-4
colon cancer 1475 5.89390809063246E-4
invasive ductal carcinoma 2950 6.39412622682472E-4
psoriasis 6685 0.00139561078087548
ductal carcinoma in situ 1745 0.00274725300442474
group 4 medulloblastoma 1875 0.00509400533072362
glioblastoma 5572 0.00710462679517974
primitive neuroectodermal tumor 3031 0.0104246053632356
adrenocortical carcinoma 1427 0.0123201303468363
Pick disease 1893 0.0131616897560997
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0139084064992074
subependymal giant cell astrocytoma 2287 0.0157342933088257
atypical teratoid / rhabdoid tumor 4369 0.0231745369569834
non primary Sjogren syndrome sicca 840 0.02704089203187
dermatomyositis 967 0.0325615433000251
spina bifida 1064 0.0338778567703815
Disease Target Count Z-score Confidence
Colon carcinoma in situ 8 4.374 2.2

Expression

Synonym

Accession Q93062 D3DSU9 Q92516 Q92517 Q92518 Q96J26 RBP-MS
Symbols HERMES

Gene

PDB

1BNY   5CYJ   5DET  

  Ortholog (11)

Gene RIF (2)

PMID Text
25281386 RBPMS1 is a critical repressor of AP-1 signaling and RBPMS1 activation may be a useful strategy for cancer treatment.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDS      1 - 70
RSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGTPNPSTPLPNTVPQFIAREPYELTVPAL     71 - 140
YPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWLPPSEATSQGWKSRQFC                  141 - 196
//

Text Mined References (20)

PMID Year Title
27365365 2016 Diverse alternative back-splicing and alternative splicing landscape of circular RNAs.
26347403 2016 Structural basis underlying CAC RNA recognition by the RRM domain of dimeric RNA-binding protein RBPMS.
25416956 2014 A proteome-scale map of the human interactome network.
25281386 2015 The RNA-binding protein RBPMS1 represses AP-1 signaling and regulates breast cancer cell proliferation and migration.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22174390 2012 Heritability of submaximal exercise heart rate response to exercise training is accounted for by nine SNPs.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...