Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.93
PubTator Score 7.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.8e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.384 1.8e-05

Gene RIF (4)

AA Sequence

MELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPE      1 - 70
LLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVET     71 - 140
VVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLN    141 - 210
AFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRPIF    211 - 280
WMEKDI                                                                    281 - 286
//

Text Mined References (10)

PMID Year Title