Property Summary

NCBI Gene PubMed Count 12
Grant Count 28
R01 Count 28
Funding $2,368,459.29
PubMed Score 23.27
PubTator Score 32.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis and treatment for 6 months 1.400 0.000
lung cancer 1.100 0.027

Gene RIF (5)

PMID Text
24766810 Data link tRNA maturation to neuronal development and neurodegeneration through defective CLP1 function in humans.
24766809 Study reports the identification of a human CLP1 mutation that impairs tRNA splicing in vitro and causes a neurological syndrome involving both the central nervous system (CNS) and peripheral nervous system (PNS).
18648070 Expression of hClp1 in budding yeast can complement conditional and lethal mutations in the essential 5'-OH RNA kinase module of yeast or plant tRNA ligases.
17495927 the kinase hClp1 phosphorylates and licenses synthetic siRNAs to become assembled into RISC for subsequent target RNA cleavage
11060040 HEAB is a pre-mRNA 3'-end processing factor, which bridges two other pre-mRNA processing factors (CF Im and CPSF) and is involved in cleavage of the pre-mRNA. It can be UV-crosslinked to GTP.

AA Sequence

MGEEANDDKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELTRNKKFTFDAGAKVAVFTWHG      1 - 70
CSVQLSGRTEVAYVSKDTPMLLYLNTHTALEQMRRQAEKEEERGPRVMVVGPTDVGKSTVCRLLLNYAVR     71 - 140
LGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSIQAPLVYHFGSTTPGTNIKLYNKITSRLADV    141 - 210
FNQRCEVNRRASVSGCVINTCGWVKGSGYQALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLP    211 - 280
KSGGVVERSKDFRRECRDERIREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQL    281 - 350
KLVPVTPGRDMVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFTVLSPAPRPLPKNFLLIMDIR    351 - 420
FMDLK                                                                     421 - 425
//

Text Mined References (14)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24766810 2014 CLP1 founder mutation links tRNA splicing and maturation to cerebellar development and neurodegeneration.
24766809 2014 Human CLP1 mutations alter tRNA biogenesis, affecting both peripheral and central nervous system function.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
18648070 2008 Human RNA 5'-kinase (hClp1) can function as a tRNA splicing enzyme in vivo.
17495927 2007 The human RNA kinase hClp1 is active on 3' transfer RNA exons and short interfering RNAs.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15109492 2004 Identification of a human endonuclease complex reveals a link between tRNA splicing and pre-mRNA 3' end formation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...