Property Summary

NCBI Gene PubMed Count 12
PubMed Score 27.97
PubTator Score 32.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.100 2.7e-02
tuberculosis and treatment for 6 months 1.400 1.0e-05

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MGEEANDDKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELTRNKKFTFDAGAKVAVFTWHG      1 - 70
CSVQLSGRTEVAYVSKDTPMLLYLNTHTALEQMRRQAEKEEERGPRVMVVGPTDVGKSTVCRLLLNYAVR     71 - 140
LGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSIQAPLVYHFGSTTPGTNIKLYNKITSRLADV    141 - 210
FNQRCEVNRRASVSGCVINTCGWVKGSGYQALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLP    211 - 280
KSGGVVERSKDFRRECRDERIREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQL    281 - 350
KLVPVTPGRDMVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFTVLSPAPRPLPKNFLLIMDIR    351 - 420
FMDLK                                                                     421 - 425
//

Text Mined References (14)

PMID Year Title