Property Summary

NCBI Gene PubMed Count 87
PubMed Score 46.89
PubTator Score 59.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (39)

Disease log2 FC p
acute quadriplegic myopathy 1.065 2.9e-03
adult high grade glioma 1.200 1.1e-03
Alzheimer's disease 1.200 1.5e-02
astrocytic glioma 1.100 1.6e-03
Astrocytoma, Pilocytic 1.400 3.0e-07
Atopic dermatitis 1.200 9.3e-05
atypical teratoid / rhabdoid tumor 1.100 1.0e-02
Crohn's disease -1.053 3.4e-02
dermatomyositis 1.600 2.0e-04
ependymoma 1.400 5.3e-11
esophageal adenocarcinoma 1.500 2.5e-02
glioblastoma 1.900 7.7e-13
group 3 medulloblastoma 1.100 8.4e-03
hepatocellular carcinoma 1.100 1.3e-04
intraductal papillary-mucinous adenoma (... 1.100 5.5e-04
intraductal papillary-mucinous carcinoma... 1.300 4.8e-04
intraductal papillary-mucinous neoplasm ... 1.100 2.5e-02
invasive ductal carcinoma 1.100 3.9e-03
juvenile dermatomyositis 1.001 3.7e-07
lung cancer 1.100 4.7e-04
medulloblastoma, large-cell 1.100 1.5e-03
Multiple myeloma 1.083 4.9e-03
non primary Sjogren syndrome sicca -1.100 1.8e-02
non-small cell lung cancer 1.789 2.2e-26
oligodendroglioma 1.100 2.5e-03
osteosarcoma 1.397 2.7e-04
ovarian cancer -1.500 7.0e-10
pancreatic cancer 1.100 5.6e-03
pancreatic carcinoma 1.100 5.6e-03
pancreatic ductal adenocarcinoma liver m... 1.274 3.5e-02
permanent atrial fibrillation -1.100 2.4e-02
Pick disease 1.600 7.3e-07
primitive neuroectodermal tumor 1.100 3.1e-06
psoriasis -1.300 4.0e-04
Rheumatoid arthritis 1.100 1.8e-02
subependymal giant cell astrocytoma 1.132 1.4e-02
tuberculosis -1.300 4.1e-05
ulcerative colitis -1.458 1.8e-02
Waldenstrons macroglobulinemia 1.147 9.4e-03

Gene RIF (66)

AA Sequence

MVWDRQTKMEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDE      1 - 70
PTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPK     71 - 140
LCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFLQFFKHSSPKIRSHAVACVNQFI    141 - 210
ISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALVMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENV    211 - 280
ALEACEFWLTLAEQPICKDVLVRHLPKLIPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRS    281 - 350
RTVAQQHDEDGIEEEDDDDDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWV    351 - 420
VKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKPLM    421 - 490
TELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSV    491 - 560
GHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQ    561 - 630
AMLNNAQPDQYEAPDKDFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPEVRQSSFALLG    631 - 700
DLTKACFQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEIINRPN    701 - 770
TPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDF    771 - 840
IFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV                841 - 898
//

Text Mined References (93)

PMID Year Title