Property Summary

NCBI Gene PubMed Count 80
Grant Count 62
R01 Count 46
Funding $13,639,710.47
PubMed Score 43.24
PubTator Score 59.28

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92973 B4DVC6 Q92957 Q92975
Symbols MIP
TRN
IPO2
MIP1
KPNB2

Gene

PANTHER Protein Class (1)

PDB

2OT8   1QBK   4FDD   4FQ3   2H4M   2QMR   2Z5J   2Z5K   2Z5M   2Z5N   2Z5O   4JLQ   4OO6  

Gene RIF (70)

PMID Text
26056081 FGF2 nuclear translocation is regulated by Karyopherin-beta2 and Ran GTPase in human glioblastoma cells
26052940 Kapbeta2 interacts with ULK2 through ULK2's putative PY-NLS motif, and facilitates transport from the cytoplasm to the nucleus, depending on its Ser1027 residue phosphorylation by PKA, thereby reducing autophagic activity.
24780099 Studies indicate potential roles of Tranportin-1 and Transportin-2 beyond protein nuclear import.
24753571 ADAR1 carries a unique nuclear localization signal (NLS) that overlaps one of its double-stranded RNA-binding domains (dsRBDs). This dsRBD-NLS is recognized by nuclear import receptor transportin 1 (also called karyopherin-beta2) in an RNA-sensitive manner.
24200467 Data suggest the C-terminal nuclear localization domain (QYP) is critical for RAM (RNMT-activating mini protein) to enter the cell nucleus where RAM activates RNMT resulting in mRNA cap methylation; TNPO1/TNPO2 mediate RAM nuclear entry.
23535894 Crystal structure of human Karyopherin beta2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2
23333309 Disulfide formation with transportin-1 is required for nuclear localization and the activation of FOXO4 induced by reactive oxygen species.
23266416 In case of L7, importin beta2 or importin beta3 are preferentially used by clusters with a high import efficiency.
23056579 The crystal structure of the FUS-NLS/Trn1 complex shows extensive contacts between the two proteins and a unique alpha-helical structure in the FUS-NLS.
23012356 Identification of a karyopherin beta1/beta2 proline-tyrosine nuclear localization signal in huntingtin protein.
More...

AA Sequence

MVWDRQTKMEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDE      1 - 70
PTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPK     71 - 140
LCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFLQFFKHSSPKIRSHAVACVNQFI    141 - 210
ISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALVMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENV    211 - 280
ALEACEFWLTLAEQPICKDVLVRHLPKLIPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRS    281 - 350
RTVAQQHDEDGIEEEDDDDDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWV    351 - 420
VKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKPLM    421 - 490
TELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSV    491 - 560
GHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQ    561 - 630
AMLNNAQPDQYEAPDKDFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPEVRQSSFALLG    631 - 700
DLTKACFQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEIINRPN    701 - 770
TPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDF    771 - 840
IFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV                841 - 898
//

Text Mined References (86)

PMID Year Title
26056081 2015 Nuclear translocation of fibroblast growth factor-2 (FGF2) is regulated by Karyopherin-?2 and Ran GTPase in human glioblastoma cells.
26052940 2015 ULK2 Ser 1027 Phosphorylation by PKA Regulates Its Nuclear Localization Occurring through Karyopherin Beta 2 Recognition of a PY-NLS Motif.
24780099 2014 Transportin-1 and Transportin-2: protein nuclear import and beyond.
24753571 2014 A bimodular nuclear localization signal assembled via an extended double-stranded RNA-binding domain acts as an RNA-sensing signal for transportin 1.
24200467 2014 RAM function is dependent on Kap?2-mediated nuclear entry.
23535894 2013 Crystal structure of human Karyopherin ?2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
23333309 2013 Redox-dependent control of FOXO/DAF-16 by transportin-1.
23266416 2013 The quantitative assessment of the role played by basic amino acid clusters in the nuclear uptake of human ribosomal protein L7.
23056579 2012 FUS-NLS/Transportin 1 complex structure provides insights into the nuclear targeting mechanism of FUS and the implications in ALS.
23012356 2012 Identification of a karyopherin ?1/?2 proline-tyrosine nuclear localization signal in huntingtin protein.
More...