Property Summary

NCBI Gene PubMed Count 33
Grant Count 29
R01 Count 18
Funding $6,862,961.02
PubMed Score 586.59
PubTator Score 53.38

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
26850138 cytoplasmic OATP2A1 likely facilitates prostaglandin E2 loading into suitable intracellular compartment(s) for efficient exocytotic prostaglandin E2 release from colorectal cancer cells exposed to oxidative stress
26539716 findings indicate that loss-of-function mutations in the SLCO2A1 gene encoding a prostaglandin transporter cause the hereditary enteropathy CNSU
26464663 overexpression of SLCO2A1 could induce and knockdown inhibit the invasion of lung cancer cells. expression levels of p-mTOR, p-AKT and p-S6 were up-regulated or down-regulated with the overexpression or knockdown of SLCO2A1.
26265282 SLCO2A1 and NOS3 are involved with prostaglandin reuptake/metabolism and nitric oxide production, respectively, and are consistently decreased in "non-Caucasian" fetal ductus arteriosus
25433169 Multiple drug resistance-associated protein 4 (MRP4), prostaglandin transporter (PGT), and 15-hydroxyprostaglandin dehydrogenase (15-PGDH) as determinants of PGE2 levels in cancer.
25433165 OATP2A1 also diminished the PGE2-mediated expression of interleukin-8 mRNA (IL-8) and hypoxia-inducible-factor 1alpha (HIF1alpha) protein in AGS-OATP2A1 cells.
25059581 In this article we describe a novel mutation in the SLCO2A1 causing Pachydermoperiostosis in a Lebanese family
24929850 a novel nonsense mutation p.E141* of the SLCO2A1 gene is associated with pachydermoperiostosis
24838973 SLCO2A1 has a role in familial digital clubbing, colon neoplasia, and NSAID resistance
24694755 Genetic variability in key genes in prostaglandin E2 pathway (COX-2, HPGD, ABCC4 and SLCO2A1) and their involvement in colorectal cancer development.
More...

AA Sequence

MGLLPKLGASQGSDTSTSRAGRCARSVFGNIKVFVLCQGLLQLCQLLYSAYFKSSLTTIEKRFGLSSSSS      1 - 70
GLISSLNEISNAILIIFVSYFGSRVHRPRLIGIGGLFLAAGAFILTLPHFLSEPYQYTLASTGNNSRLQA     71 - 140
ELCQKHWQDLPPSKCHSTTQNPQKETSSMWGLMVVAQLLAGIGTVPIQPFGISYVDDFSEPSNSPLYISI    141 - 210
LFAISVFGPAFGYLLGSVMLQIFVDYGRVNTAAVNLVPGDPRWIGAWWLGLLISSALLVLTSFPFFFFPR    211 - 280
AMPIGAKRAPATADEARKLEEAKSRGSLVDFIKRFPCIFLRLLMNSLFVLVVLAQCTFSSVIAGLSTFLN    281 - 350
KFLEKQYGTSAAYANFLIGAVNLPAAALGMLFGGILMKRFVFSLQAIPRIATTIITISMILCVPLFFMGC    351 - 420
STPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYL    421 - 490
NCSCVTGGSASAKTGSCPVPCAHFLLPAIFLISFVSLIACISHNPLYMMVLRVVNQEEKSFAIGVQFLLM    491 - 560
RLLAWLPSPALYGLTIDHSCIRWNSLCLGRRGACAYYDNDALRDRYLGLQMGYKALGMLLLCFISWRVKK    561 - 630
NKEYNVQKAAGLI                                                             631 - 643
//

Text Mined References (35)

PMID Year Title
26850138 2016 Role of OATP2A1 in PGE(2) secretion from human colorectal cancer cells via exocytosis in response to oxidative stress.
26539716 2015 A Hereditary Enteropathy Caused by Mutations in the SLCO2A1 Gene, Encoding a Prostaglandin Transporter.
26464663 2015 Prostaglandin transporter, SLCO2A1, mediates the invasion and apoptosis of lung cancer cells via PI3K/AKT/mTOR pathway.
26265282 2015 Effects of Advancing Gestation and Non-Caucasian Race on Ductus Arteriosus Gene Expression.
25433169 Multiple drug resistance-associated protein 4 (MRP4), prostaglandin transporter (PGT), and 15-hydroxyprostaglandin dehydrogenase (15-PGDH) as determinants of PGE2 levels in cancer.
25433165 2015 Interplay between the prostaglandin transporter OATP2A1 and prostaglandin E2-mediated cellular effects.
25059581 2015 Pachydermoperiostosis genetic screening in Lebanese families uncovers a novel SLCO2A1mutation.
24929850 2014 The complete type of pachydermoperiostosis: a novel nonsense mutation p.E141* of the SLCO2A1 gene.
24838973 2014 Inactivating mutation in the prostaglandin transporter gene, SLCO2A1, associated with familial digital clubbing, colon neoplasia, and NSAID resistance.
24694755 2014 Genetic variability in key genes in prostaglandin E2 pathway (COX-2, HPGD, ABCC4 and SLCO2A1) and their involvement in colorectal cancer development.
More...