Property Summary

NCBI Gene PubMed Count 20
Grant Count 67
R01 Count 49
Funding $10,527,511.31
PubMed Score 85.88
PubTator Score 42.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Synonym

Accession Q92949 O00630
Symbols HFH4
HFH-4
FKHL13

Gene

 GO Component (1)

Gene RIF (12)

PMID Text
26690880 In ependymomas and choroid plexus tumours, reduced expression of FOXJ1 and its ciliogenesis programme are markers of poor outcome
25201258 Both protein and mRNA levels of ciliogenesis-associated markers CP110, Foxj1, TAp73 were significantly increased in patients with nasal polyps versus those seen in control subjects and were positively correlated with cilia length
24828273 By stimulating ciliogenesis with the transcription factor FOXJ1, it may be possible to maintain close to normal cilia length despite the stress of cigarette smoking.
24809300 Decreased FOXJ1 expression was correlated with clinic stage, lymph node metastasis, and distant metastasis, and lower FOXJ1 expression independently predicted shorter survival time in gastric carcinoma.
23822649 FOXJ1 is an important regulator of cilia gene expression during ciliated cell differentiation, with RFX3 as a transcriptional co-activator to FOXJ1.
23479743 Rer1p depletion reduced ciliary length and function by increasing gamma-secretase complex assembly and activity and, consequently, enhancing Notch signaling as well as reducing Foxj1a expression.
22945654 Nanog-mediated cell migration and invasion involved its regulation of E-cadherin and FOXJ1.
22488567 FOXJ1 was overexpressed in HCCs and associated with histological grade and poor prognosis.
20539013 goblet cells formed in response to IL-13 treatment are in part or wholly derived from progenitors that express the ciliated cell marker, FOXJ1
18160851 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAPALPPGGTDPHGYHQVPGSAA      1 - 70
PGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKAT     71 - 140
KITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAF    141 - 210
KKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPK    211 - 280
RVAKVPRPPSTLLPTPEEQGELEPLKGNFDWEAIFDAGTLGGELGALEALELSPPLSPASHVDVDLTIHG    281 - 350
RHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAF    351 - 420
L//

Text Mined References (20)

PMID Year Title
26690880 2016 Decreased FOXJ1 expression and its ciliogenesis programme in aggressive ependymoma and choroid plexus tumours.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25201258 2014 Impairment of cilia architecture and ciliogenesis in hyperplastic nasal epithelium from nasal polyps.
24828273 2014 FOXJ1 prevents cilia growth inhibition by cigarette smoke in human airway epithelium in vitro.
24809300 2015 Decreased expression of FOXJ1 is a potential prognostic predictor for progression and poor survival of gastric cancer.
23822649 2013 RFX3 modulation of FOXJ1 regulation of cilia genes in the human airway epithelium.
23479743 2013 Rer1p maintains ciliary length and signaling by regulating ?-secretase activity and Foxj1a levels.
22945654 2013 Stem cell transcription factor NANOG controls cell migration and invasion via dysregulation of E-cadherin and FoxJ1 and contributes to adverse clinical outcome in ovarian cancers.
22488567 2013 Expression of FOXJ1 in hepatocellular carcinoma: correlation with patients' prognosis and tumor cell proliferation.
20539013 2011 Goblet cells are derived from a FOXJ1-expressing progenitor in a human airway epithelium.
More...