Property Summary

NCBI Gene PubMed Count 22
PubMed Score 800.36
PubTator Score 19.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 2.3172803634682E-14
malignant mesothelioma 3163 9.131960100742E-9
atypical teratoid / rhabdoid tumor 4369 5.81642733402055E-6
pilocytic astrocytoma 3086 1.59156093859955E-4
cystic fibrosis 1670 1.61830272008004E-4
medulloblastoma 1524 2.64252133538268E-4
lung cancer 4473 2.99913767276366E-4
medulloblastoma, large-cell 6234 7.07627020000248E-4
glioblastoma 5572 0.00109942544832791
adult high grade glioma 2148 0.00117889266972093
oligodendroglioma 2849 0.00143095683323378
colon cancer 1475 0.00146798033259917
astrocytoma 1493 0.00237938537188117
head and neck cancer 270 0.00369054335292688
ependymoma 2514 0.00453303259210593
chronic rhinosinusitis 512 0.00902730664041163
Pick disease 1893 0.0106419678777184
primitive neuroectodermal tumor 3031 0.0470134613050285

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 2.800 0.000
astrocytoma -3.800 0.002
ependymoma -2.900 0.005
oligodendroglioma -2.100 0.001
glioblastoma -4.000 0.001
medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -4.600 0.001
primitive neuroectodermal tumor -2.000 0.047
colon cancer -2.900 0.001
lung cancer 2.900 0.000
cystic fibrosis -1.600 0.000
adult high grade glioma -3.600 0.001
pilocytic astrocytoma -3.100 0.000
Pick disease -1.900 0.011
ovarian cancer -4.100 0.000
chronic rhinosinusitis -1.020 0.009
head and neck cancer -1.100 0.004

Synonym

Accession Q92913 B1AK18 B7Z4M7 B7Z8N0 D3DWH4 O95830 Q9NZH9 Q9NZI0 FGF-13
Symbols FGF2
FHF2
FHF-2
FGF-13

Gene

PANTHER Protein Class (2)

PDB

4DCK   4JPZ   3HBW  

  Ortholog (11)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (8)

PMID Text
26891277 for PCa patients after RP, FGF13 serves as a potential novel prognostic marker that improves prediction of BCR-free survival, in particular if combined with other clinical parameters.
26063919 The findings of this study reveal a novel cause of this syndrome and underscore the powerful role of FGF13 in control of neuronal excitability.
24113164 Upregulated expression of FGF13/FHF2 mediates resistance to platinum drugs in cervical cancer cells
23603273 FGF13 has a role in hair follicle growth and in the hair cycle as shown in a family with X-linked congenital generalized hypertrichosis
23373430 X-chromosome deletions may be a cause of WS with larger deletions being lethal to males and that FGF13 mutations may be a cause of Wildervanck Syndrome (WS).
15282281 FHF2B is an interacting partner of Na(v)1.6. The preferential expression of FHF2B in sensory neurons may provide a basis for physiological differences in sodium currents that have been reported at the nodes of Ranvier in sensory versus motor axons.
12496262 identification of a domain controlling angiogenic properties
11847221 interactions with perlecans

AA Sequence

MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRPEPQLKGIV      1 - 70
TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKLYLAMNSEGYLYTSELFTPE     71 - 140
CKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLH    141 - 210
DLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST                                       211 - 245
//

Text Mined References (29)

PMID Year Title
26891277 2016 Increased expression of fibroblast growth factor 13 in prostate cancer is associated with shortened time to biochemical recurrence after radical prostatectomy.
26392562 2015 SCN5A variant that blocks fibroblast growth factor homologous factor regulation causes human arrhythmia.
26063919 2015 Disruption of Fgf13 causes synaptic excitatory-inhibitory imbalance and genetic epilepsy and febrile seizures plus.
24113164 2013 Upregulated expression of FGF13/FHF2 mediates resistance to platinum drugs in cervical cancer cells.
23603273 2013 Position effect on FGF13 associated with X-linked congenital generalized hypertrichosis.
23373430 2014 Xq26.3 microdeletion in a male with Wildervanck Syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
21817159 2011 Fibroblast growth factor homologous factor 13 regulates Na+ channels and conduction velocity in murine hearts.
21566136 2011 Identification of novel interaction sites that determine specificity between fibroblast growth factor homologous factors and voltage-gated sodium channels.
More...