Property Summary

NCBI Gene PubMed Count 22
Grant Count 18
R01 Count 12
Funding $2,211,466.06
PubMed Score 800.36
PubTator Score 19.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 2.800 0.000
astrocytoma -3.800 0.002
ependymoma -2.900 0.005
oligodendroglioma -2.100 0.001
glioblastoma -4.000 0.001
medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -4.600 0.001
primitive neuroectodermal tumor -2.000 0.047
colon cancer -2.900 0.001
lung cancer 2.900 0.000
cystic fibrosis -1.600 0.000
adult high grade glioma -3.600 0.001
pilocytic astrocytoma -3.100 0.000
Pick disease -1.900 0.011
ovarian cancer -4.100 0.000
chronic rhinosinusitis -1.020 0.009
head and neck cancer -1.100 0.004

Gene RIF (8)

PMID Text
26891277 for PCa patients after RP, FGF13 serves as a potential novel prognostic marker that improves prediction of BCR-free survival, in particular if combined with other clinical parameters.
26063919 The findings of this study reveal a novel cause of this syndrome and underscore the powerful role of FGF13 in control of neuronal excitability.
24113164 Upregulated expression of FGF13/FHF2 mediates resistance to platinum drugs in cervical cancer cells
23603273 FGF13 has a role in hair follicle growth and in the hair cycle as shown in a family with X-linked congenital generalized hypertrichosis
23373430 X-chromosome deletions may be a cause of WS with larger deletions being lethal to males and that FGF13 mutations may be a cause of Wildervanck Syndrome (WS).
15282281 FHF2B is an interacting partner of Na(v)1.6. The preferential expression of FHF2B in sensory neurons may provide a basis for physiological differences in sodium currents that have been reported at the nodes of Ranvier in sensory versus motor axons.
12496262 identification of a domain controlling angiogenic properties
11847221 interactions with perlecans

AA Sequence

MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRPEPQLKGIV      1 - 70
TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKLYLAMNSEGYLYTSELFTPE     71 - 140
CKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLH    141 - 210
DLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST                                       211 - 245
//

Text Mined References (29)

PMID Year Title
26891277 2016 Increased expression of fibroblast growth factor 13 in prostate cancer is associated with shortened time to biochemical recurrence after radical prostatectomy.
26392562 2015 SCN5A variant that blocks fibroblast growth factor homologous factor regulation causes human arrhythmia.
26063919 2015 Disruption of Fgf13 causes synaptic excitatory-inhibitory imbalance and genetic epilepsy and febrile seizures plus.
24113164 2013 Upregulated expression of FGF13/FHF2 mediates resistance to platinum drugs in cervical cancer cells.
23603273 2013 Position effect on FGF13 associated with X-linked congenital generalized hypertrichosis.
23373430 2014 Xq26.3 microdeletion in a male with Wildervanck Syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
21817159 2011 Fibroblast growth factor homologous factor 13 regulates Na+ channels and conduction velocity in murine hearts.
21566136 2011 Identification of novel interaction sites that determine specificity between fibroblast growth factor homologous factors and voltage-gated sodium channels.
More...