Property Summary

NCBI Gene PubMed Count 26
PubMed Score 831.91
PubTator Score 19.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.800 2.3e-03
astrocytic glioma -2.100 1.1e-03
Astrocytoma, Pilocytic -3.100 4.4e-06
atypical teratoid / rhabdoid tumor -3.000 5.8e-06
chronic rhinosinusitis -1.020 9.0e-03
colon cancer -2.900 1.5e-03
cystic fibrosis -1.600 1.6e-04
ependymoma -2.300 1.0e-03
glioblastoma -2.900 4.9e-09
group 4 medulloblastoma -1.900 3.4e-02
head and neck cancer -1.100 3.7e-03
lung cancer 2.900 3.0e-04
malignant mesothelioma 2.800 9.1e-09
medulloblastoma, large-cell -3.300 3.5e-03
oligodendroglioma -2.100 1.4e-03
ovarian cancer -4.100 2.3e-14
Pick disease -1.200 9.7e-03
primitive neuroectodermal tumor -2.000 4.7e-02

Gene RIF (12)

AA Sequence

MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRPEPQLKGIV      1 - 70
TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKLYLAMNSEGYLYTSELFTPE     71 - 140
CKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLH    141 - 210
DLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST                                       211 - 245
//

Text Mined References (33)

PMID Year Title