Property Summary

NCBI Gene PubMed Count 136
Grant Count 100
R01 Count 74
Funding $7,727,546.22
PubMed Score 207.15
PubTator Score 138.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.163 0.007
Multiple myeloma 1.552 0.000
psoriasis 1.100 0.001
group 4 medulloblastoma -1.200 0.000
ovarian cancer 2.800 0.000

Synonym

Accession Q92905 O15386 Q6AW95 Q86WQ4 Q9BQ17 SGN5
Symbols CSN5
JAB1
SGN5
MOV-34

Gene

PANTHER Protein Class (1)

PDB

4D10   4D18   4WSN   4F7O  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
651999 screening 1402 / 0 / 362766 uHTS identification of small molecule inhibitors of Csn-mediated Deneddylation of Cullin-Ring Ligases, vis a fluorescence polarization assay
652009 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of Csn-mediated Deneddylation of Cullin-Ring Ligases
652285 confirmatory 34 / 0 / 6 SAR Analysis & Validation of Small Molecule uHTS RPN11 Inhibitor Hits Using a Csn-mediated Deneddylation of Cullin-Ring Ligase Fluorescence Polarization Assay
686916 confirmatory 46 / 0 / 4 SAR Analysis & Validation of Small Molecule uHTS RPN11 Inhibitor Hits Using a Csn-mediated Deneddylation of Cullin-Ring Ligase Fluorescence Polarization Assay, set 2

Gene RIF (91)

PMID Text
26719032 Copine3 binding to ErbB2 increases when Jab1 is overexpressed in SKBr3 breast cancer cells. PI3 kinase and AKT were also activated by Jab1 overexpression.Copine3 and Jab1 binding regulates the ErbB2 signaling pathway.
26606000 Jab1/Csn5 expression with concurrent low p57 expression associated with poor overall survival in hepatocellular carcinoma
26464677 The reverse correlation of Jab1 and Smad4 in PANC-1 cells may be involved in the Pathogenesis of prostate cancer. Jab1 can cause degradation of Smad4 via TGF-beta signal pathway.
26352431 LPA stimulated interaction of CSN5 with HIF1alpha and MIF. Depletion of CSN5 mitigated the association between HIF1alpha and MIF. We suggest HIF1alpha, MIF, and CSN5 form a ternary complex that is necessary to prevent degradation of HIF1alpha under aerobic conditions
26048783 Knockdown of CSN5 could inhibit proliferation and promote apoptosis of gastric cancer cells. Additionally, suppression of CSN5 expression contributed to the increased expression levels of p53 and Bax.
26045788 Down regulation of CSN5 may inhibit invasion and arrests cell cycle progression in colorectal cancer via PI3K/AKT/NF-kappaB signal pathway.
26035694 Integrin beta-1, transforming growth factorbeta1 and nuclear factorkappaB pathways are modified by CSN5 in hepatocllular carcinoma cells.
25666480 Jab1 expression was increased in endometriosis.
25505242 The interaction of HIV-1 CA with human cellular COP9 signalosome subunit 5 protein (COPS5) is identified by yeast two-hybrid screen
24882689 CSN5 promotes SIAH-1 degradation in HCT116 and SW480 cells and that this is associated with its deNEDDylase activity.
More...

AA Sequence

MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHAR      1 - 70
SGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSH     71 - 140
PGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNK    141 - 210
IEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQL    211 - 280
GRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS                    281 - 334
//

Text Mined References (140)

PMID Year Title
26719032 2016 Direct binding of Copine3 with Jab1 activates downstream ErbB2 signaling and motility in SKBr3 breast cancer cells.
26606000 2016 Down-regulation of the cyclin-dependent kinase inhibitor p57 is mediated by Jab1/Csn5 in hepatocarcinogenesis.
26464677 2015 Reverse correlation of Jab1 and Smad4 in PANC-1 cells involved in the pathogenesis of pancreatic cancer.
26456823 2015 CSNAP Is a Stoichiometric Subunit of the COP9 Signalosome.
26352431 2015 HIF1?-Induced by Lysophosphatidic Acid Is Stabilized via Interaction with MIF and CSN5.
26048783 2015 Suppression of CSN5 promotes the apoptosis of gastric cancer cells through regulating p53-related apoptotic pathways.
26045788 2015 CSN5 silencing inhibits invasion and arrests cell cycle progression in human colorectal cancer SW480 and LS174T cells in vitro.
26035694 2015 CSN5 silencing reverses sorafenib resistance of human hepatocellular carcinoma HepG2 cells.
25666480 2015 Expression of p27 and Jun activation domain-binding protein 1 in endometriosis.
24882689 2014 The ?-catenin E3 ubiquitin ligase SIAH-1 is regulated by CSN5/JAB1 in CRC cells.
More...