Property Summary

NCBI Gene PubMed Count 148
PubMed Score 213.63
PubTator Score 138.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma, Hepatocellular 228 0.0 0.0
Stevens-Johnson syndrome 92 0.0 0.0
Disease Target Count
Liver carcinoma 240
Disease Target Count P-value
group 4 medulloblastoma 1855 2.2e-05
ovarian cancer 8520 8.8e-05
Multiple myeloma 1332 2.7e-04
psoriasis 6694 9.9e-04
Waldenstrons macroglobulinemia 765 6.6e-03
Disease Target Count Z-score Confidence
Cancer 2499 4.03 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma -1.200 2.2e-05
Multiple myeloma 1.552 2.7e-04
ovarian cancer 2.800 8.8e-05
psoriasis 1.100 9.9e-04
Waldenstrons macroglobulinemia 1.163 6.6e-03

Protein-protein Interaction (13)

Gene RIF (98)

AA Sequence

MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHAR      1 - 70
SGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSH     71 - 140
PGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNK    141 - 210
IEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQL    211 - 280
GRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS                    281 - 334
//

Text Mined References (152)

PMID Year Title