Property Summary

NCBI Gene PubMed Count 14
PubMed Score 14.90
PubTator Score 202.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MLELRHRGSCPGPREAVSPPHREGEAAGGDHETESTSDKETDIDDRYGDLDSRTDSDIPEIPPSSDRTPE      1 - 70
ILKKALSGLSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYDLP     71 - 140
WFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMFVLSLVKKHYRLQ    141 - 210
FYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYLFGFFFGRTPLIKLSPKKTWEGF    211 - 280
IGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQERVSLY    281 - 350
PFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRG    351 - 420
PNPSKVLQQLLVLQPEQQLNIYKTLKTHLIEKGILQPTLKV                                 421 - 461
//

Text Mined References (16)

PMID Year Title