Property Summary

NCBI Gene PubMed Count 13
Grant Count 68
R01 Count 66
Funding $7,370,398
PubMed Score 14.90
PubTator Score 202.24

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92903 B2RAL5 O00163
Symbols CDS

Gene

Gene RIF (3)

PMID Text
25375833 distinct properties of the two isoforms of CDP-diacylglycerol synthase
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLELRHRGSCPGPREAVSPPHREGEAAGGDHETESTSDKETDIDDRYGDLDSRTDSDIPEIPPSSDRTPE      1 - 70
ILKKALSGLSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYDLP     71 - 140
WFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMFVLSLVKKHYRLQ    141 - 210
FYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYLFGFFFGRTPLIKLSPKKTWEGF    211 - 280
IGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQERVSLY    281 - 350
PFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRG    351 - 420
PNPSKVLQQLLVLQPEQQLNIYKTLKTHLIEKGILQPTLKV                                 421 - 461
//

Text Mined References (15)

PMID Year Title
25375833 2014 Distinct properties of the two isoforms of CDP-diacylglycerol synthase.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16461635 2006 Decoding the fine-scale structure of a breast cancer genome and transcriptome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9889000 1999 Identification and characterization of CDS2, a mammalian homolog of the Drosophila CDP-diacylglycerol synthase gene.
More...