Property Summary

NCBI Gene PubMed Count 13
PubMed Score 14.90
PubTator Score 202.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
oligodendroglioma 2849 1.02651403074084E-13
pilocytic astrocytoma 3086 3.94676419078985E-13
pediatric high grade glioma 2712 9.38470335507927E-10
malignant mesothelioma 3163 1.62112440390586E-8
sonic hedgehog group medulloblastoma 1482 2.14248838283835E-8
glioblastoma 5572 8.99702883135303E-8
medulloblastoma, large-cell 6234 1.04232868446824E-7
atypical teratoid / rhabdoid tumor 4369 6.50675113600546E-7
ovarian cancer 8492 6.74897186199495E-6
posterior fossa group A ependymoma 1511 1.38900919696112E-5
primitive neuroectodermal tumor 3031 3.83250707033546E-5
interstitial cystitis 2299 1.02041739662104E-4
nasopharyngeal carcinoma 1056 1.05027366073314E-4
pancreatic cancer 2300 2.36632409965728E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.34747458571838E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.78783434778102E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.83011926567899E-4
Pick disease 1893 0.00120525157911533
ductal carcinoma in situ 1745 0.00193633011342143
astrocytic glioma 2241 0.00222511739033002
invasive ductal carcinoma 2950 0.00599732862659933
subependymal giant cell astrocytoma 2287 0.00684514930385626
primary pancreatic ductal adenocarcinoma 1271 0.00747269288187826
fibroadenoma 557 0.0304448030123101
progressive supranuclear palsy 674 0.0311128270736442
spina bifida 1064 0.0348116322620757
Disease Target Count Z-score Confidence
Barth syndrome 23 4.524 2.3
Sleeping sickness 37 3.851 1.9

Expression

Synonym

Accession Q92903 B2RAL5 O00163
Symbols CDS

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (3)

PMID Text
25375833 distinct properties of the two isoforms of CDP-diacylglycerol synthase
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLELRHRGSCPGPREAVSPPHREGEAAGGDHETESTSDKETDIDDRYGDLDSRTDSDIPEIPPSSDRTPE      1 - 70
ILKKALSGLSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYDLP     71 - 140
WFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMFVLSLVKKHYRLQ    141 - 210
FYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYLFGFFFGRTPLIKLSPKKTWEGF    211 - 280
IGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQERVSLY    281 - 350
PFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRG    351 - 420
PNPSKVLQQLLVLQPEQQLNIYKTLKTHLIEKGILQPTLKV                                 421 - 461
//

Text Mined References (15)

PMID Year Title
25375833 2014 Distinct properties of the two isoforms of CDP-diacylglycerol synthase.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16461635 2006 Decoding the fine-scale structure of a breast cancer genome and transcriptome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9889000 1999 Identification and characterization of CDS2, a mammalian homolog of the Drosophila CDP-diacylglycerol synthase gene.
More...