Property Summary

NCBI Gene PubMed Count 14
PubMed Score 34.89
PubTator Score 22.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Gene RIF (6)

AA Sequence

MSWHPQYRSSKFRHVFGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGK      1 - 70
LDPHYPKVCGHRGNVLDVKWNPFDDFEIASCSEDATIKIWSIPKQLLTRNLTAYRKELVGHARRVGLVEW     71 - 140
HPTAANILFSAGYDYKVMIWNLDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPR    141 - 210
AGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYDA    211 - 280
DTSMLYVVGKGDGNIRYYEVSADKPHLSYLTEYRSYNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLI    281 - 350
EPISMIVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMA    351 - 420
PASPRLLNQTEKLAAEDGWRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQ    421 - 490
QEEIRRLRELLTQREVQAKQLELEIKNLRMGSEQL                                       491 - 525
//

Text Mined References (15)

PMID Year Title