Property Summary

NCBI Gene PubMed Count 12
PubMed Score 35.23
PubTator Score 22.73

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
26373535 increased expression of coronin 2A is associated with the malignant phenotype of human colon carcinoma.
23490283 The candidate marker CORO2A rs1985859 and the putative marker FAM101A rs7955740 may be of value for the prediction of radiosensitivity to preoperative colorectal tumors.
20526340 Observational study of gene-disease association. (HuGE Navigator)
19654210 Coronin 2A and cofilin regulate a subset of focal-adhesion-turnover events.
12628926 This protein is one of 10-12 associated proteins in the purified N-CoR complex.

AA Sequence

MSWHPQYRSSKFRHVFGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGK      1 - 70
LDPHYPKVCGHRGNVLDVKWNPFDDFEIASCSEDATIKIWSIPKQLLTRNLTAYRKELVGHARRVGLVEW     71 - 140
HPTAANILFSAGYDYKVMIWNLDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPR    141 - 210
AGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYDA    211 - 280
DTSMLYVVGKGDGNIRYYEVSADKPHLSYLTEYRSYNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLI    281 - 350
EPISMIVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMA    351 - 420
PASPRLLNQTEKLAAEDGWRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQ    421 - 490
QEEIRRLRELLTQREVQAKQLELEIKNLRMGSEQL                                       491 - 525
//

Text Mined References (13)

PMID Year Title
26373535 2015 Coronin 2A (CRN5) expression is associated with colorectal adenoma-adenocarcinoma sequence and oncogenic signalling.
23490283 2013 Novel single-nucleotide polymorphism markers predictive of pathologic response to preoperative chemoradiation therapy in rectal cancer patients.
20526340 2010 Common variants in FOXP1 are associated with generalized vitiligo.
19654210 2009 Coronin 2A regulates a subset of focal-adhesion-turnover events through the cofilin pathway.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14527417 2003 N-CoR mediates DNA methylation-dependent repression through a methyl CpG binding protein Kaiso.
12628926 2003 Purification and functional characterization of the human N-CoR complex: the roles of HDAC3, TBL1 and TBLR1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...