Property Summary

NCBI Gene PubMed Count 42
PubMed Score 207.19
PubTator Score 90.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma -2.262 2.0e-02
Alzheimer's disease -1.100 3.3e-02
astrocytic glioma 1.700 1.6e-02
atypical teratoid / rhabdoid tumor -3.000 1.1e-05
ependymoma -1.400 1.3e-04
group 4 medulloblastoma -2.900 8.8e-08
interstitial cystitis 1.400 8.4e-04
intraductal papillary-mucinous adenoma (... -4.600 6.3e-10
intraductal papillary-mucinous carcinoma... -3.700 3.0e-03
intraductal papillary-mucinous neoplasm ... -4.300 9.0e-05
lung cancer 2.400 5.5e-04
lung carcinoma 3.500 6.3e-36
medulloblastoma, large-cell -1.700 3.9e-02
non-small cell lung cancer 1.203 3.8e-05
oligodendroglioma 1.800 3.9e-03
ovarian cancer -1.700 4.2e-03
pancreatic cancer -1.300 6.1e-03
Pick disease -1.100 2.5e-04
primary pancreatic ductal adenocarcinoma -1.885 8.9e-05
primitive neuroectodermal tumor -1.500 2.1e-03
ulcerative colitis 1.100 1.8e-02

Protein-protein Interaction (3)

Gene RIF (20)

AA Sequence

MQLKIMPKKKRLSAGRVPLILFLCQMISALEVPLDPKLLEDLVQPPTITQQSPKDYIIDPRENIVIQCEA      1 - 70
KGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVR     71 - 140
PSRSPLWTKEKLEPITLQSGQSLVLPCRPPIGLPPPIIFWMDNSFQRLPQSERVSQGLNGDLYFSNVLPE    141 - 210
DTREDYICYARFNHTQTIQQKQPISVKVISVDELNDTIAANLSDTEFYGAKSSRERPPTFLTPEGNASNK    211 - 280
EELRGNVLSLECIAEGLPTPIIYWAKEDGMLPKNRTVYKNFEKTLQIIHVSEADSGNYQCIAKNALGAIH    281 - 350
HTISVRVKAAPYWITAPQNLVLSPGEDGTLICRANGNPKPRISWLTNGVPIEIAPDDPSRKIDGDTIIFS    351 - 420
NVQERSSAVYQCNASNEYGYLLANAFVNVLAEPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFK    421 - 490
GAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDPTWIVKQPEYAVVQRG    491 - 560
SMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDHLVVADVSDDDSGTYTCVANTTLDSVSASAV    561 - 630
LSVVAPTPTPAPVYDVPNPPFDLELTDQLDKSVQLSWTPGDDNNSPITKFIIEYEDAMHKPGLWHHQTEV    631 - 700
SGTQTTAQLKLSPYVNYSFRVMAVNSIGKSLPSEASEQYLTKASEPDKNPTAVEGLGSEPDNLVITWKPL    701 - 770
NGFESNGPGLQYKVSWRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDMGFAPEPAVVMGHS    771 - 840
GEDLPMVAPGNVRVNVVNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKTQSSSKRNRRHIEKKILTFQGSK    841 - 910
THGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEGVPSAPSSLKIVNPTLDSLTLEWDPPSHPNG    911 - 980
ILTEYTLKYQPINSTHELGPLVDLKIPANKTRWTLKNLNFSTRYKFYFYAQTSAGSGSQITEEAVTTVDE    981 - 1050
AGILPPDVGAGKVQAVNPRISNLTAAAAETYANISWEYEGPEHVNFYVEYGVAGSKEEWRKEIVNGSRSF   1051 - 1120
FGLKGLMPGTAYKVRVGAVGDSGFVSSEDVFETGPAMASRQVDIATQGWFIGLMCAVALLILILLIVCFI   1121 - 1190
RRNKGGKYPVKEKEDAHADPEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYGE   1191 - 1260
GVNGQFNEDGSFIGQYSGKKEKEPAEGNESSEAPSPVNAMNSFV                             1261 - 1304
//

Text Mined References (48)

PMID Year Title