Property Summary

NCBI Gene PubMed Count 41
Grant Count 88
R01 Count 57
Funding $16,337,999.93
PubMed Score 196.34
PubTator Score 90.13

Knowledge Summary

Patent

No data available

Expression

Gene

PDB

1UEN   1UEY  

 GO Function (1)

Gene RIF (19)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of neuronal cell adhesion molecule (NRCAM) in primary human brain microvascular endothelial cells
23338556 A high level of Nr-CAM expression is associated with favorable tumor phenotype and reduced risk of prostate cancer recurrence.
22182708 mechanisms of NrCAM participation in development and how these might be perturbed in disorders are reviewed. [review]
21876539 Genome-wide association analysis of coffee drinking suggests association with CYP1A1/CYP1A2 and NRCAM
21718388 Nr-CAM protein expression is upregulated in colorectal cancer tissues; Nr-CAM overexpression is an independent marker of poor prognosis among advanced CRC patients, and a possible predictive marker for non-beneficence to 5-fluorouracil-based chemotherapy
20602751 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20039944 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19598235 Observational study of gene-disease association. (HuGE Navigator)
19154219 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQLKIMPKKKRLSAGRVPLILFLCQMISALEVPLDPKLLEDLVQPPTITQQSPKDYIIDPRENIVIQCEA      1 - 70
KGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVR     71 - 140
PSRSPLWTKEKLEPITLQSGQSLVLPCRPPIGLPPPIIFWMDNSFQRLPQSERVSQGLNGDLYFSNVLPE    141 - 210
DTREDYICYARFNHTQTIQQKQPISVKVISVDELNDTIAANLSDTEFYGAKSSRERPPTFLTPEGNASNK    211 - 280
EELRGNVLSLECIAEGLPTPIIYWAKEDGMLPKNRTVYKNFEKTLQIIHVSEADSGNYQCIAKNALGAIH    281 - 350
HTISVRVKAAPYWITAPQNLVLSPGEDGTLICRANGNPKPRISWLTNGVPIEIAPDDPSRKIDGDTIIFS    351 - 420
NVQERSSAVYQCNASNEYGYLLANAFVNVLAEPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFK    421 - 490
GAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDPTWIVKQPEYAVVQRG    491 - 560
SMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDHLVVADVSDDDSGTYTCVANTTLDSVSASAV    561 - 630
LSVVAPTPTPAPVYDVPNPPFDLELTDQLDKSVQLSWTPGDDNNSPITKFIIEYEDAMHKPGLWHHQTEV    631 - 700
SGTQTTAQLKLSPYVNYSFRVMAVNSIGKSLPSEASEQYLTKASEPDKNPTAVEGLGSEPDNLVITWKPL    701 - 770
NGFESNGPGLQYKVSWRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDMGFAPEPAVVMGHS    771 - 840
GEDLPMVAPGNVRVNVVNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKTQSSSKRNRRHIEKKILTFQGSK    841 - 910
THGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEGVPSAPSSLKIVNPTLDSLTLEWDPPSHPNG    911 - 980
ILTEYTLKYQPINSTHELGPLVDLKIPANKTRWTLKNLNFSTRYKFYFYAQTSAGSGSQITEEAVTTVDE    981 - 1050
AGILPPDVGAGKVQAVNPRISNLTAAAAETYANISWEYEGPEHVNFYVEYGVAGSKEEWRKEIVNGSRSF   1051 - 1120
FGLKGLMPGTAYKVRVGAVGDSGFVSSEDVFETGPAMASRQVDIATQGWFIGLMCAVALLILILLIVCFI   1121 - 1190
RRNKGGKYPVKEKEDAHADPEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYGE   1191 - 1260
GVNGQFNEDGSFIGQYSGKKEKEPAEGNESSEAPSPVNAMNSFV                             1261 - 1304
//

Text Mined References (47)

PMID Year Title
23897819 2013 Myocilin mediates myelination in the peripheral nervous system through ErbB2/3 signaling.
23593202 2013 Bivariate genome-wide association analyses identified genes with pleiotropic effects for femoral neck bone geometry and age at menarche.
23338556 2013 High Nr-CAM expression is associated with favorable phenotype and late PSA recurrence in prostate cancer treated by prostatectomy.
22182708 2012 The role of NrCAM in neural development and disorders--beyond a simple glue in the brain.
21876539 2012 Genome-wide association analysis of coffee drinking suggests association with CYP1A1/CYP1A2 and NRCAM.
21718388 2011 Overexpression of neurone glial-related cell adhesion molecule is an independent predictor of poor prognosis in advanced colorectal cancer.
20602751 2010 Generalist genes analysis of DNA markers associated with mathematical ability and disability reveals shared influence across ages and abilities.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20039944 2010 A genome-wide association study identifies multiple loci associated with mathematics ability and disability.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
More...