Property Summary

NCBI Gene PubMed Count 17
Grant Count 38
R01 Count 21
Funding $8,093,282.84
PubMed Score 25.73
PubTator Score 16.32

Knowledge Summary

Patent (1,862)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.800 0.001
ependymoma -4.800 0.000
oligodendroglioma -1.700 0.022
glioblastoma -4.200 0.000
medulloblastoma -4.700 0.000
atypical teratoid / rhabdoid tumor -5.100 0.000
medulloblastoma, large-cell -5.000 0.000
primitive neuroectodermal tumor -3.800 0.000
pediatric high grade glioma -3.700 0.000
pilocytic astrocytoma -2.500 0.000
subependymal giant cell astrocytoma -2.721 0.018
Pick disease -1.300 0.014

Gene RIF (7)

PMID Text
21637918 This study is the first to identify the expression of GIRK2-4 subunits in human esophageal smooth muscle cells.
20610389 a decisive role for the neuronal K(+) channel in regulating NCAM-dependent neurite outgrowth and attribute a physiologically meaningful role to the functional interplay of Kir3.3, NCAM, and TrkB in ontogeny
19995671 The frequencies of GRIK3 (T928G) genotype distributions in the patients with schizophrenia were similar to those of their relatives.
17727731 Observational study of gene-disease association. (HuGE Navigator)
16109170 GIRK1 and GIRK2 channels, but not GIRK3 or GIRK4, may may activate signaling pathways in development of lung cancer
15911117 Observational study of gene-disease association. (HuGE Navigator)
11350189 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYAL      1 - 70
TWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLL     71 - 140
LQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLI    141 - 210
RSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMV    211 - 280
EATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLY    281 - 350
WSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV                               351 - 393
//

Text Mined References (17)

PMID Year Title
21637918 Identification of GIRK2-4 subunits in human esophageal smooth muscle cells.
20610389 2010 Functional consequences of the interactions among the neural cell adhesion molecule NCAM, the receptor tyrosine kinase TrkB, and the inwardly rectifying K+ channel KIR3.3.
19995671 2010 Are GRIK3 (T928G) gene variants in schizophrenia patients different from those in their first-degree relatives?
18391953 2008 Rare independent mutations in renal salt handling genes contribute to blood pressure variation.
17727731 2007 Association analysis of chromosome 1 migraine candidate genes.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16382105 2005 International Union of Pharmacology. LIV. Nomenclature and molecular relationships of inwardly rectifying potassium channels.
16109170 2005 Expression of G-protein inwardly rectifying potassium channels (GIRKs) in lung cancer cell lines.
15911117 2005 No association between common variations in the human alpha 2 subunit gene (ATP1A2) of the sodium-potassium-transporting ATPase and idiopathic generalized epilepsy.
More...