Property Summary

NCBI Gene PubMed Count 17
PubMed Score 27.22
PubTator Score 16.32

Knowledge Summary

Patent (1,862)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 7.0e-03
astrocytic glioma -1.500 1.2e-03
Astrocytoma, Pilocytic -2.500 3.7e-10
atypical teratoid / rhabdoid tumor -1.700 4.4e-09
ependymoma -1.500 1.3e-03
glioblastoma -1.200 6.6e-06
group 3 medulloblastoma -1.400 2.4e-02
medulloblastoma, large-cell -1.400 2.2e-04
oligodendroglioma -1.700 2.2e-02
Pick disease -1.300 1.4e-02
primitive neuroectodermal tumor -1.700 6.0e-06
subependymal giant cell astrocytoma -1.634 2.6e-02

Gene RIF (7)

AA Sequence

MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYAL      1 - 70
TWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLL     71 - 140
LQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLI    141 - 210
RSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMV    211 - 280
EATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLY    281 - 350
WSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV                               351 - 393
//

Text Mined References (17)

PMID Year Title