Property Summary

NCBI Gene PubMed Count 22
Grant Count 20
R01 Count 5
Funding $2,957,483.25
PubMed Score 0.22
PubTator Score 15.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.200 0.002
ependymoma -2.000 0.006
oligodendroglioma -2.000 0.003
psoriasis -1.100 0.001
osteosarcoma 1.205 0.001
glioblastoma -2.300 0.000
cystic fibrosis 1.759 0.000
group 4 medulloblastoma -2.800 0.000
primitive neuroectodermal tumor -1.900 0.000
lung cancer 1.800 0.023
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.900 0.000
invasive ductal carcinoma -1.305 0.010
nasopharyngeal carcinoma 1.100 0.001
lung carcinoma -1.200 0.000
Breast cancer -1.500 0.000
pituitary cancer -1.100 0.000

Gene RIF (17)

PMID Text
24431330 Two candidate loci in each family and homozygous truncating mutations p.R611X in TAF4B in family 1 and p.K507Sfs*3 in ZMYND15 in family 2, were identified.
20353996 We show evidence for the first time of an interdependence of TAF4b and AP-1 family members in cell type-specific promoter recognition and initiation of transcription in the context of cancer progression and EMT.
19635797 Findings suggest that DNA binding by TAF4/4b-TAF12 facilitates the association of TFIID with the core promoter of a subset of genes.
19508998 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19020761 Expression of the TAF4b gene is induced by MYC through a non-canonical, but not canonical, E-box which contributes to its specific response to MYC.
18206971 TAF4b incorporation into TFIID induces an open conformation at the lobe involved in TFIIA & putative activator interactions, correlating with differential activator-dependent transcription & promoter recognition by 4b/4-IID.
16088961 work suggests that pre-mRNA processing and post-translational modification represent two important regulatory steps for the gonad-specific functions of human TAF(II)105
15601843 histone fold domain mediated interaction enhances the DNA binding activity of each of the TAF6-TAF9 and TAF4b-TAF12 pairs and of a histone-like octamer complex composed of the four TAFs
9054383 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
8849451 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
More...

AA Sequence

MPAGLTEPAGAAPPAAVSASGTVTMAPAGALPVRVESTPVALGAVTKAPVSVCVEPTASQPLRSPVGTLV      1 - 70
TKVAPVSAPPKVSSGPRLPAPQIVAVKAPNTTTIQFPANLQLPPGTVLIKSNSGPLMLVSPQQTVTRAET     71 - 140
TSNITSRPAVPANPQTVKICTVPNSSSQLIKKVAVTPVKKLAQIGTTVVTTVPKPSSVQSVAVPTSVVTV    141 - 210
TPGKPLNTVTTLKPSSLGASSTPSNEPNLKAENSAAVQINLSPTMLENVKKCKNFLAMLIKLACSGSQSP    211 - 280
EMGQNVKKLVEQLLDAKIEAEEFTRKLYVELKSSPQPHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSS    281 - 350
DMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAA    351 - 420
TGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVTLSLPAVTFGETSGAAICLPSVKPVVSS    421 - 490
AGTTSDKPVIGTPVQIKLAQPGPVLSQPAGIPQAVQVKQLVVQQPSGGNEKQVTTISHSSTLTIQKCGQK    491 - 560
TMPVNTIIPTSQFPPASILKQITLPGNKILSLQASPTQKNRIKENVTSCFRDEDDINDVTSMAGVNLNEE    561 - 630
NACILATNSELVGTLIQSCKDEPFLFIGALQKRILDIGKKHDITELNSDAVNLISQATQERLRGLLEKLT    631 - 700
AIAQHRMTTYKASENYILCSDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKA    701 - 770
KELQQLELAQIQHRDANLTALAAIGPRKKRPLESGIEGLKDNLLASGTSSLTATKQLHRPRITRICLRDL    771 - 840
IFCMEQEREMKYSRALYLALLK                                                    841 - 862
//

Text Mined References (24)

PMID Year Title
24653979 2014 Targeting TBP-Associated Factors in Ovarian Cancer.
24431330 2014 Truncating mutations in TAF4B and ZMYND15 causing recessive azoospermia.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20353996 2010 TAF4b and Jun/activating protein-1 collaborate to regulate the expression of integrin alpha6 and cancer cell migration properties.
19635797 2009 TAF4/4b x TAF12 displays a unique mode of DNA binding and is required for core promoter function of a subset of genes.
19508998 2009 Genome-wide association study in premature ovarian failure patients suggests ADAMTS19 as a possible candidate gene.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...