Property Summary

NCBI Gene PubMed Count 45
PubMed Score 18.98
PubTator Score 69.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 8.9e-06
Breast cancer 1.600 4.8e-12
breast carcinoma 1.200 5.8e-05
group 3 medulloblastoma 1.200 3.8e-05
lung adenocarcinoma 2.200 3.9e-11
malignant mesothelioma 1.300 3.4e-05
medulloblastoma, large-cell 1.500 6.3e-05
non-small cell lung cancer 1.388 6.5e-16
ovarian cancer 1.600 6.1e-12
psoriasis 1.600 1.2e-94

Gene RIF (27)

AA Sequence

MRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTNQPPCLDSSQH      1 - 70
EAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLDKEKLP     71 - 140
VHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCIMADEMGLGKTLQCITLMWTLLRQSPECKPE    141 - 210
IDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRL    211 - 280
HVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTA    281 - 350
HEFKKHFELPILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQ    351 - 420
TELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDLFPPGYSSKAL    421 - 490
EPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFN    491 - 560
SPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEK    561 - 630
IFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCT    631 - 700
SDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR                           701 - 747
//

Text Mined References (46)

PMID Year Title