Property Summary

NCBI Gene PubMed Count 44
Grant Count 16
R01 Count 10
Funding $952,379.34
PubMed Score 17.27
PubTator Score 69.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
602329 screening 506 / 213 / 360689 Identification of inhibitors of RAD54 Measured in Biochemical System Using Plate Reader - 2159-01_Inhibitor_SinglePoint_HTS_Activity
602352 summary 0 / 0 / 0 Broad Institute Identification of Inhibitors of RAD54 Probe Project
651651 confirmatory 0 / 0 / 59 Identification of Rad54 Inhibitors - Ruling Out Flurescence Quenchers Measured in Biochemical System Using Plate Reader - 2159-03_Inhibitor_Dose_CherryPick_Activity
651657 confirmatory 394 / 0 / 63 Identification of Inhibitors of RAD54 Measured in Biochemical System Using Plate Reader - 2159-01_Inhibitor_Dose_CherryPick_Activity

Gene RIF (27)

PMID Text
25965574 TAF12 and NFYC are transcription factors that regulate the epigenome, whereas RAD54L plays a central role in DNA repair
25765654 support a model in which RAD54L and RAD54B counteract genome-destabilizing effects of direct binding of RAD51 to dsDNA in tumor cells
24798879 Nap1 binds to RAD54.
20813000 Meta-analysis of gene-disease association. (HuGE Navigator)
20610542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTNQPPCLDSSQH      1 - 70
EAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLDKEKLP     71 - 140
VHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCIMADEMGLGKTLQCITLMWTLLRQSPECKPE    141 - 210
IDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRL    211 - 280
HVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTA    281 - 350
HEFKKHFELPILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQ    351 - 420
TELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDLFPPGYSSKAL    421 - 490
EPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFN    491 - 560
SPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEK    561 - 630
IFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCT    631 - 700
SDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR                           701 - 747
//

Text Mined References (45)

PMID Year Title
25965574 2015 Cross-Species Genomics Identifies TAF12, NFYC, and RAD54L as Choroid Plexus Carcinoma Oncogenes.
25765654 2015 RAD54 family translocases counter genotoxic effects of RAD51 in human tumor cells.
25416956 2014 A proteome-scale map of the human interactome network.
24798879 2014 Nap1 stimulates homologous recombination by RAD51 and RAD54 in higher-ordered chromatin containing histone H1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22705370 2012 The HARP-like domain-containing protein AH2/ZRANB3 binds to PCNA and participates in cellular response to replication stress.
22153077 2011 Structural basis and sequence rules for substrate recognition by Tankyrase explain the basis for cherubism disease.
20813000 2010 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma in a pooled analysis of three studies.
20610542 2010 Gamma-radiation sensitivity and polymorphisms in RAD51L1 modulate glioma risk.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
More...