Property Summary

NCBI Gene PubMed Count 73
PubMed Score 210.47
PubTator Score 153.33

Knowledge Summary

Patent (23,418)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 3.14183399449645E-19
malignant mesothelioma 3163 1.56035850165709E-8
osteosarcoma 7933 8.31415628808581E-8
oligodendroglioma 2849 2.16741099674268E-7
Duchenne muscular dystrophy 602 2.37976906728561E-7
ovarian cancer 8492 4.94914824389954E-7
group 4 medulloblastoma 1875 7.47952905353085E-7
medulloblastoma, large-cell 6234 9.49768727370038E-6
colon cancer 1475 1.61237637218346E-5
primitive neuroectodermal tumor 3031 6.39439714068966E-4
pituitary cancer 1972 0.00127300341031004
psoriasis 6685 0.00175202550285958
Down syndrome 548 0.00328767187260592
invasive ductal carcinoma 2950 0.00429830959653634
primary Sjogren syndrome 789 0.00486201330001058
pediatric high grade glioma 2712 0.00520130994713195
Atopic dermatitis 944 0.00550001517062041
lung cancer 4473 0.00589307181743942
glioblastoma 5572 0.00698752117239068
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0133586730310319
adrenocortical carcinoma 1427 0.0150915797897054
astrocytic glioma 2241 0.0230365221707772
subependymal giant cell astrocytoma 2287 0.0247188908672853
ependymoma 2514 0.0466396225206823
Disease Target Count Z-score Confidence
Corneal disease 32 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.591 1.8
Pulmonary Fibrosis 66 3.067 1.5

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -5.200 0.000
astrocytic glioma -2.600 0.023
ependymoma -2.400 0.047
psoriasis -1.700 0.002
oligodendroglioma -1.900 0.000
osteosarcoma 3.837 0.000
glioblastoma -1.700 0.007
group 4 medulloblastoma -3.400 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -2.000 0.001
Duchenne muscular dystrophy 1.099 0.000
autosomal dominant Emery-Dreifuss muscul... 1.012 0.013
Atopic dermatitis -1.400 0.006
adrenocortical carcinoma -1.853 0.015
colon cancer -2.100 0.000
lung cancer -2.000 0.006
pediatric high grade glioma -1.500 0.005
primary Sjogren syndrome 1.100 0.005
subependymal giant cell astrocytoma -2.044 0.025
lung carcinoma -1.800 0.000
invasive ductal carcinoma -1.900 0.004
ovarian cancer -2.000 0.000
pituitary cancer -1.200 0.001
Down syndrome 1.400 0.003

Synonym

Accession Q92633 B4DK36 O00656 O00722 P78351 LPA receptor 1
Symbols EDG2
LPA1
VZG1
GPR26
edg-2
vzg-1
Gpcr26
Mrec1.3
rec.1.3

Gene

PANTHER Protein Class (2)

PDB

4Z34   4Z35   4Z36  

  Ortholog (13)

  TechDev Info (1)

Gene RIF (57)

PMID Text
26740622 Data suggest LPA (lysophosphatidic acid; acting via LPAR1) and endothelin activate Cdc42, concurrent with biphasic decrease in Rac1 activity, differential effects on RhoA; LPA/endothelin stim. leads to remodeling of invadosomes in melanoma cells.
26327335 Data show high expression levels of LPAR2 and LPAR1 in endometrial cancer tissue with positive correlations with FIGO stage suggesting them as potential biomarkers for endometrial cancer progression.
26268898 LPA-type agonist, via Carbonyl-oxygen/Lys39 interaction facilitates the formation of a hypothetical N-terminal cap tightly packed over the LPA1 heptahelical bundle.
26123684 we show that LPAR1 is a novel susceptibility gene for human essential hypertension and that stress, such as shortage of sleep, increases the susceptibility of patients with risk allele to essential hypertension.
26091040 Study presents three crystal structures of LPA1 in complex with antagonist tool compounds selected and designed through structural and stability analyses.
25273676 Results indicate that lysophosphatidic acid-lysophosphatidic acid receptor 1 (LPA-LPA1) signaling contributes to the activation of rheumatoid arthritis fibroblast-like synoviocytes (FLSs).
24828490 HB-EGF is a biomarker for LPA1 receptor activation in human breast and prostate cancers.
24061591 LPA1 and LPA2 are major LPA receptor subtypes compared with low-expressed LPA3 in PANC-1 tumor cells.
23838008 Lysophosphatidylethanolamine utilizes LPA(1) and CD97 in a breast cancer cell line.
23569130 Lysophosphatidic acid (LPA) increased hepatocellular carcinoma cells cell invasion, which was LPA-receptor dependent.
More...

AA Sequence

MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVCIFIMLANLLV      1 - 70
MVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLL     71 - 140
AIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIENCSNMAPLYSDSYLVFW    141 - 210
AIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLL    211 - 280
DVCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNH    281 - 350
TILAGVHSNDHSVV                                                            351 - 364
//

Text Mined References (79)

PMID Year Title
26740622 2016 Rapid Remodeling of Invadosomes by Gi-coupled Receptors: DISSECTING THE ROLE OF Rho GTPases.
26327335 2015 The significance of the altered expression of lysophosphatidic acid receptors, autotaxin and phospholipase A2 as the potential biomarkers in type 1 endometrial cancer biology.
26268898 2015 Lys39-Lysophosphatidate Carbonyl Oxygen Interaction Locks LPA1 N-terminal Cap to the Orthosteric Site and partners Arg124 During Receptor Activation.
26123684 2015 Genetic and Functional Evidence Supports LPAR1 as a Susceptibility Gene for Hypertension.
26091040 2015 Crystal Structure of Antagonist Bound Human Lysophosphatidic Acid Receptor 1.
25732591 2015 Comparative analyses of lysophosphatidic acid receptor-mediated signaling.
25273676 2014 Activation of fibroblast-like synoviocytes derived from rheumatoid arthritis via lysophosphatidic acid-lysophosphatidic acid receptor 1 cascade.
25025571 2014 Molecular regulation of lysophosphatidic acid receptor 1 trafficking to the cell surface.
24828490 2014 Identification of heparin-binding EGF-like growth factor (HB-EGF) as a biomarker for lysophosphatidic acid receptor type 1 (LPA1) activation in human breast and prostate cancers.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
More...