Property Summary

Ligand Count 22
NCBI Gene PubMed Count 80
PubMed Score 222.69
PubTator Score 153.33

Knowledge Summary

Patent (23,418)

TINX Plot

  Disease (6)

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -1.853 1.5e-02
adult high grade glioma -1.100 3.9e-02
astrocytic glioma -2.600 2.3e-02
Atopic dermatitis -1.400 5.5e-03
autosomal dominant Emery-Dreifuss muscul... 1.012 1.3e-02
colon cancer -1.300 3.2e-02
Down syndrome 1.400 3.3e-03
Duchenne muscular dystrophy 1.099 2.4e-07
ependymoma -2.400 4.7e-02
glioblastoma -1.100 3.7e-02
group 3 medulloblastoma -2.400 1.8e-03
invasive ductal carcinoma -1.900 4.3e-03
lung cancer -2.000 5.9e-03
lung carcinoma -1.800 3.1e-19
malignant mesothelioma -5.200 1.6e-08
medulloblastoma, large-cell -3.100 1.0e-05
oligodendroglioma -1.900 2.2e-07
osteosarcoma 3.837 8.3e-08
ovarian cancer -2.000 4.9e-07
pituitary cancer -1.200 1.3e-03
primary Sjogren syndrome 1.100 4.9e-03
primitive neuroectodermal tumor -1.900 7.4e-03
psoriasis -1.300 5.9e-05
subependymal giant cell astrocytoma -2.044 2.5e-02

Gene RIF (62)

AA Sequence

MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVCIFIMLANLLV      1 - 70
MVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLL     71 - 140
AIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIENCSNMAPLYSDSYLVFW    141 - 210
AIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLL    211 - 280
DVCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNH    281 - 350
TILAGVHSNDHSVV                                                            351 - 364
//

Text Mined References (86)

PMID Year Title