Property Summary

NCBI Gene PubMed Count 35
PubMed Score 119.85
PubTator Score 41.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.8
Liver cancer 604 0.0 0.5
Disease Target Count
Anterior Segment Dysgenesis 7 2

Expression

  Differential Expression (28)

Disease log2 FC p
pancreatic cancer 1.200 4.9e-03
adult high grade glioma 1.600 1.4e-04
astrocytic glioma 1.800 3.9e-03
Astrocytoma, Pilocytic 2.400 4.4e-09
atypical teratoid / rhabdoid tumor 2.900 2.9e-07
Breast cancer 2.700 2.7e-02
chronic kidney disease 1.500 9.3e-03
dermatomyositis 1.600 6.8e-03
Duchenne muscular dystrophy 1.384 1.9e-09
ependymoma 1.200 1.7e-03
esophageal adenocarcinoma 1.800 1.8e-02
gastric carcinoma 1.700 5.9e-03
glioblastoma 2.500 6.7e-10
group 3 medulloblastoma 2.300 7.2e-05
interstitial cystitis 2.400 3.9e-05
intraductal papillary-mucinous adenoma (... -1.700 1.4e-02
juvenile dermatomyositis 1.332 6.3e-10
lung cancer 1.100 5.5e-04
malignant mesothelioma -1.400 3.1e-07
nasopharyngeal carcinoma 1.100 4.4e-02
non-small cell lung cancer 1.039 2.8e-05
oligodendroglioma 1.800 4.4e-03
ovarian cancer 1.900 3.7e-04
pituitary cancer -2.400 1.1e-08
primary pancreatic ductal adenocarcinoma 1.574 7.1e-03
primitive neuroectodermal tumor 2.500 8.0e-04
psoriasis 1.400 3.6e-04
ulcerative colitis 2.300 7.0e-06

Gene RIF (22)

AA Sequence

MAKRSRGPGRRCLLALVLFCAWGTLAVVAQKPGAGCPSRCLCFRTTVRCMHLLLEAVPAVAPQTSILDLR      1 - 70
FNRIREIQPGAFRRLRNLNTLLLNNNQIKRIPSGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLY     71 - 140
LHFNQIETLDPDSFQHLPKLERLFLHNNRITHLVPGTFNHLESMKRLRLDSNTLHCDCEILWLADLLKTY    141 - 210
AESGNAQAAAICEYPRRIQGRSVATITPEELNCERPRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWL    211 - 280
RNNNELSMKTDSRLNLLDDGTLMIQNTQETDQGIYQCMAKNVAGEVKTQEVTLRYFGSPARPTFVIQPQN    281 - 350
TEVLVGESVTLECSATGHPPPRISWTRGDRTPLPVDPRVNITPSGGLYIQNVVQGDSGEYACSATNNIDS    351 - 420
VHATAFIIVQALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTKGGSQLSVDRRHLVLSSGTLRIS    421 - 490
GVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDTTVEVGANVQLPCSSQGEPEPAITWNK    491 - 560
DGVQVTESGKFHISPEGFLTINDVGPADAGRYECVARNTIGSASVSMVLSVNVPDVSRNGDPFVATSIVE    561 - 630
AIATVDRAINSTRTHLFDSRPRSPNDLLALFRYPRDPYTVEQARAGEIFERTLQLIQEHVQHGLMVDLNG    631 - 700
TSYHYNDLVSPQYLNLIANLSGCTAHRRVNNCSDMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSV    701 - 770
YENGFNTPRGINPHRLYNGHALPMPRLVSTTLIGTETVTPDEQFTHMLMQWGQFLDHDLDSTVVALSQAR    771 - 840
FSDGQHCSNVCSNDPPCFSVMIPPNDSRARSGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQLTSYI    841 - 910
DASNVYGSTEHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANE    911 - 980
QLGLTSMHTLWFREHNRIATELLKLNPHWDGDTIYYETRKIVGAEIQHITYQHWLPKILGEVGMRTLGEY    981 - 1050
HGYDPGINAGIFNAFATAAFRFGHTLVNPLLYRLDENFQPIAQDHLPLHKAFFSPFRIVNEGGIDPLLRG   1051 - 1120
LFGVAGKMRVPSQLLNTELTERLFSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAHTFEDLKN   1121 - 1190
EIKNPEIREKLKRLYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQFKRLRDGDRLWYENPGVFSPA   1191 - 1260
QLTQIKQTSLARILCDNADNITRVQSDVFRVAEFPHGYGSCDEIPRVDLRVWQDCCEDCRTRGQFNAFSY   1261 - 1330
HFRGRRSLEFSYQEDKPTKKTRPRKIPSVGRQGEHLSNSTSAFSTRSDASGTNDFREFVLEMQKTITDLR   1331 - 1400
TQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVC   1401 - 1470
LQKRAEEKP                                                                1471 - 1479
//

Text Mined References (37)

PMID Year Title