Property Summary

NCBI Gene PubMed Count 30
PubMed Score 6.55
PubTator Score 518.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Neoplasms 63 0.0 0.0
Pre-Eclampsia 68 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 2.8e-02
gastric carcinoma 1.400 1.4e-02
interstitial cystitis 1.800 1.8e-03
lung cancer -1.500 1.8e-04
malignant mesothelioma 2.300 4.8e-08
nephrosclerosis 1.031 1.3e-04
osteosarcoma -2.096 4.1e-04
ovarian cancer 1.400 3.5e-04
psoriasis 1.800 4.7e-04
subependymal giant cell astrocytoma 2.073 1.3e-02

Gene RIF (16)

AA Sequence

MFSRKKRELMKTPSISKKNRAGSPSPQPSGELPRKDGADAVFPGPSLEPPAGSSGVKATGTLKRPTSLSR      1 - 70
HASAAGFPLSGAASWTLGRSHRSPLTAASPGELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLRD     71 - 140
DLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAAGTLIAKVKAFHYESNNDLEKQEFEKALETI    141 - 210
AVAFSSTVSEFLMGEVDSSTLLAVPPGDSSQSMESLYGPGSEGTPPSLEDCDAGCLPAEEVDVLLQRCEG    211 - 280
GVDAALLYAKNMAKYMKDLISYLEKRTTLEMEFAKGLQKIAHNCRQSVMQEPHMPLLSIYSLALEQDLEF    281 - 350
GHSMVQAVGTLQTQTFMQPLTLRRLEHEKRRKEIKEAWHRAQRKLQEAESNLRKAKQGYVQRCEDHDKAR    351 - 420
FLVAKAEEEQAGSAPGAGSTATKTLDKRRRLEEEAKNKAEEAMATYRTCVADAKTQKQELEDTKVTALRQ    421 - 490
IQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFE    491 - 560
PHVSANAWSPVMRARKSSFNVSDVARPEAAGSPPEEGGCTEGTPAKDHRAGRGHQVHKSWPLSISDSDSG    561 - 630
LDPGPGAGDFKKFERTSSSGTMSSTEELVDPDGGAGASAFEQADLNGMTPELPVAVPSGPFRHEGLSKAA    631 - 700
RTHRLRKLRTPAKCRECNSYVYFQGAECEECCLACHKKCLETLAIQCGHKKLQGRLQLFGQDFSHAARSA    701 - 770
PDGVPFIVKKCVCEIERRALRTKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQL    771 - 840
PEPLISFRLYHELVGLAKDSLKAEAEAKAASRGRQDGSESEAVAVALAGRLRELLRDLPPENRASLQYLL    841 - 910
RHLRRIVEVEQDNKMTPGNLGIVFGPTLLRPRPTEATVSLSSLVDYPHQARVIETLIVHYGLVFEEEPEE    911 - 980
TPGGQDESSNQRAEVVVQVPYLEAGEAVVYPLQEAAADGCRESRVVSNDSDSDLEEASELLSSSEASALG    981 - 1050
HLSFLEQQQSEASLEVASGSHSGSEEQLEATAREDGDGDEDGPAQQLSGFNTNQSNNVLQAPLPPMRLRG   1051 - 1120
GRMTLGSCRERQPEFV                                                         1121 - 1136
//

Text Mined References (46)

PMID Year Title