Property Summary

NCBI Gene PubMed Count 30
PubMed Score 4.55
PubTator Score 518.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
nephrosclerosis 1.031 0.000
malignant mesothelioma 2.300 0.000
cutaneous lupus erythematosus 1.500 0.003
psoriasis -2.000 0.000
osteosarcoma -3.748 0.000
lung cancer -1.500 0.000
interstitial cystitis 1.800 0.002
subependymal giant cell astrocytoma 2.073 0.013
gastric carcinoma 1.400 0.014
ovarian cancer 1.400 0.000

Synonym

Accession Q92619 B4DTS4 F6QP70 Q6P189 Q7LE26 Q86WS1 Q8HX84 Q9GJN9 Q9GJP0 Q9GJP1 Q9MY24
Symbols HA-1
HMHA1
HLA-HA1

Gene

PANTHER Protein Class (2)

PDB

3D25   3FT3  

Gene RIF (16)

PMID Text
26095815 Placental HA-1 expression is regulated by oxygen and is increased in the syncytial nuclear aggregates and syncytiotrophoblast of preeclamptic as compared to control placentas.
24086303 study shows that HMHA1 acts as a RhoGAP to regulate GTPase activity, cytoskeletal remodeling and cell spreading, which are crucial functions in normal hematopoietic and cancer cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20509834 the information on allele and genotype frequencies of HA-1 and HA-2 in a Taiwanese population
19913121 Observational study of gene-disease association. (HuGE Navigator)
19234124 study examined antigenic presentation & T-cell recognition of HA-1, a prototypic autosomal mHag derived from single nucleotide dimorphism (HA-1(H) versus HA-1(R)) in the HMHA1 gene; results define the molecular mechanisms governing immunogenicity of HA-1
18414982 targeting mHags encoded not only by HMHA1, whose aberrant expression in solid tumors has been reported, but also BCL2A1 may bring about beneficial selective graft-versus-tumor effects
18093280 Observational study of gene-disease association. (HuGE Navigator)
17580157 There was no difference in acute rejection rates between the HA-1-matched and -mismatched groups in kidney transplantation.
16984283 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MFSRKKRELMKTPSISKKNRAGSPSPQPSGELPRKDGADAVFPGPSLEPPAGSSGVKATGTLKRPTSLSR      1 - 70
HASAAGFPLSGAASWTLGRSHRSPLTAASPGELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLRD     71 - 140
DLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAAGTLIAKVKAFHYESNNDLEKQEFEKALETI    141 - 210
AVAFSSTVSEFLMGEVDSSTLLAVPPGDSSQSMESLYGPGSEGTPPSLEDCDAGCLPAEEVDVLLQRCEG    211 - 280
GVDAALLYAKNMAKYMKDLISYLEKRTTLEMEFAKGLQKIAHNCRQSVMQEPHMPLLSIYSLALEQDLEF    281 - 350
GHSMVQAVGTLQTQTFMQPLTLRRLEHEKRRKEIKEAWHRAQRKLQEAESNLRKAKQGYVQRCEDHDKAR    351 - 420
FLVAKAEEEQAGSAPGAGSTATKTLDKRRRLEEEAKNKAEEAMATYRTCVADAKTQKQELEDTKVTALRQ    421 - 490
IQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFE    491 - 560
PHVSANAWSPVMRARKSSFNVSDVARPEAAGSPPEEGGCTEGTPAKDHRAGRGHQVHKSWPLSISDSDSG    561 - 630
LDPGPGAGDFKKFERTSSSGTMSSTEELVDPDGGAGASAFEQADLNGMTPELPVAVPSGPFRHEGLSKAA    631 - 700
RTHRLRKLRTPAKCRECNSYVYFQGAECEECCLACHKKCLETLAIQCGHKKLQGRLQLFGQDFSHAARSA    701 - 770
PDGVPFIVKKCVCEIERRALRTKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQL    771 - 840
PEPLISFRLYHELVGLAKDSLKAEAEAKAASRGRQDGSESEAVAVALAGRLRELLRDLPPENRASLQYLL    841 - 910
RHLRRIVEVEQDNKMTPGNLGIVFGPTLLRPRPTEATVSLSSLVDYPHQARVIETLIVHYGLVFEEEPEE    911 - 980
TPGGQDESSNQRAEVVVQVPYLEAGEAVVYPLQEAAADGCRESRVVSNDSDSDLEEASELLSSSEASALG    981 - 1050
HLSFLEQQQSEASLEVASGSHSGSEEQLEATAREDGDGDEDGPAQQLSGFNTNQSNNVLQAPLPPMRLRG   1051 - 1120
GRMTLGSCRERQPEFV                                                         1121 - 1136
//

Text Mined References (46)

PMID Year Title
26095815 2015 Trophoblast expression of the minor histocompatibility antigen HA-1 is regulated by oxygen and is increased in placentas from preeclamptic women.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086303 2013 The human minor histocompatibility antigen 1 is a RhoGAP.
23571587 2013 Variants in the ATP-binding cassette transporter (ABCA7), apolipoprotein E ?4,and the risk of late-onset Alzheimer disease in African Americans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20509834 2010 Minor histocompatibility antigen HA-1 and HA-2 polymorphisms in Taiwan: frequency and application in hematopoietic stem cell transplantation.
19946888 2010 Defining the membrane proteome of NK cells.
More...