Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.79
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
psoriasis -1.700 0.001
osteosarcoma -2.135 0.002
cystic fibrosis 1.348 0.000
primitive neuroectodermal tumor 1.200 0.005
lung cancer 1.200 0.000
group 3 medulloblastoma -1.300 0.001
posterior fossa group B ependymoma 1.200 0.000
Breast cancer -1.700 0.003

Synonym

Accession Q92618
Symbols HsT287

Gene

Gene RIF (3)

PMID Text
24241165 ZNF516 promoter methylation was the best biomarker, with both sensitivity and specificity of 90% (AUC = 0.92), results subsequently corroborated in a Prevalence cohort.
23045156 one interacting gene pair (RBMS3 versus ZNF516) which, even after Bonferroni correction for multiple testing, showed consistently significant effects on hip bone mineral density.
18976975 Knockdown of zinc finger protein 516 (ZNF516) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MDRNREAEMELRRGPSPTRAGRGHEVDGDKATCHTCCICGKSFPFQSSLSQHMRKHTGEKPYKCPYCDHR      1 - 70
ASQKGNLKIHIRSHRTGTLIQGHEPEAGEAPLGEMRASEGLDACASPTKSASACNRLLNGASQADGARVL     71 - 140
NGASQADSGRVLLRSSKKGAEGSACAPGEAKAAVQCSFCKSQFERKKDLELHVHQAHKPFKCRLCSYATL    141 - 210
REESLLSHIERDHITAQGPGSGEACVENGKPELSPGEFPCEVCGQAFSQTWFLKAHMKKHRGSFDHGCHI    211 - 280
CGRRFKEPWFLKNHMKAHGPKTGSKNRPKSELDPIATINNVVQEEVIVAGLSLYEVCAKCGNLFTNLDSL    281 - 350
NAHNAIHRRVEASRTRAPAEEGAEGPSDTKQFFLQCLNLRPSAAGDSCPGTQAGRRVAELDPVNSYQAWQ    351 - 420
LATRGKVAEPAEYLKYGAWDEALAGDVAFDKDRREYVLVSQEKRKREQDAPAAQGPPRKRASGPGDPAPA    421 - 490
GHLDPRSAARPNRRAAATTGQGKSSECFECGKIFRTYHQMVLHSRVHRRARRERDSDGDRAARARCGSLS    491 - 560
EGDSASQPSSPGSACAAADSPGSGLADEAAEDSGEEGAPEPAPGGQPRRCCFSEEVTSTELSSGDQSHKM    561 - 630
GDNASERDTGESKAGIAASVSILENSSRETSRRQEQHRFSMDLKMPAFHPKQEVPVPGDGVEFPSSTGAE    631 - 700
GQTGHPAEKLSDLHNKEHSGGGKRALAPDLMPLDLSARSTRDDPSNKETASSLQAALVVHPCPYCSHKTY    701 - 770
YPEVLWMHKRIWHRVSCNSVAPPWIQPNGYKSIRSNLVFLSRSGRTGPPPALGGKECQPLLLARFTRTQV    771 - 840
PGGMPGSKSGSSPLGVVTKAASMPKNKESHSGGPCALWAPGPDGYRQTKPCHGQEPHGAATQGPLAKPRQ    841 - 910
EASSKPVPAPGGGGFSRSATPTPTVIARAGAQPSANSKPVEKFGVPPAGAGFAPTNKHSAPDSLKAKFSA    911 - 980
QPQGPPPAKGEGGAPPLPPREPPSKAAQELRTLATCAAGSRGDAALQAQPGVAGAPPVLHSIKQEPVAEG    981 - 1050
HEKRLDILNIFKTYIPKDFATLYQGWGVSGPGLEHRGTLRTQARPGEFVCIECGKSFHQPGHLRAHMRAH   1051 - 1120
SVVFESDGPRGSEVHTTSADAPKQGRDHSNTGTVQTVPLRKGT                              1121 - 1163
//

Text Mined References (13)

PMID Year Title
25578880 2015 Cold-inducible Zfp516 activates UCP1 transcription to promote browning of white fat and development of brown fat.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24241165 2014 Genome-wide methylation profiling reveals Zinc finger protein 516 (ZNF516) and FK-506-binding protein 6 (FKBP6) promoters frequently methylated in cervical neoplasia, associated with HPV status and ethnicity in a Chilean population.
23446422 2013 Replication stress links structural and numerical cancer chromosomal instability.
23432519 A genome-wide association study of recipient genotype and medium-term kidney allograft function.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
23045156 2013 Gene-gene interaction between RBMS3 and ZNF516 influences bone mineral density.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...