Property Summary

NCBI Gene PubMed Count 33
Grant Count 8
Funding $2,499,582.17
PubMed Score 13.59
PubTator Score 15.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Carcinoma 2,147 1.0

Expression

Gene RIF (12)

PMID Text
24485452 Identification of the DNA-damage-induced Golgi response reveals an unexpected pathway through DNA-PK, GOLPH3, and MYO18A that regulates cell survival following DNA damage.
24162774 HIV-1 gp120 upregulates the expression of myosin XVIIIA (MYO18A) in human B cells
23990465 PDZ module mediates direct binding of myosin-18A to GOLPH3, and this interaction in turn modulates the actin binding properties of the N-terminal extension. Thus, myosin-18A can act as an actin cross-linker with multiple regulatory modulators
23345592 GOLPH3L differs critically from GOLPH3 in that it is largely unable to bind to MYO18A; data demonstrate that despite their similarities, unexpectedly, GOLPH3L antagonizes GOLPH3/MYO18A at the Golgi
21751808 Myo18aalpha as a novel binding partner of ezrin; the Myo18aalpha/ezrin complex may facilitate B cell receptor-mediated signaling
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19923322 MYO18A is a novel binding partner of the PAK2/betaPIX/GIT1 complex and suggest that MYO18A may play an important role in regulating epithelial cell migration via affecting multiple cell machineries.
19837035 GOLPH3 bridges phosphatidylinositol-4- phosphate and actomyosin (via MYO18A) to stretch and shape the Golgi to promote budding.
19006078 Study used a DNA-based long-distance inverse PCR (LDI-PCR) to identify a new MYO18A-PDGFRB fusion gene in an Eos-MPN (eosinophilia-associated atypical myeloproliferative neoplasms) with associated t(5;17)(q33-34;q11.2).
18443188 These findings support the hypothesis that SP-A, via SP-R210, suppresses cell-mediated immunity against M. tuberculosis via a mechanism that up-regulates secretion of IL-10 and TGF-beta1.[SP-A receptor]
More...

AA Sequence

MFNLMKKDKDKDGGRKEKKEKKEKKERMSAAELRSLEEMSLRRGFFNLNRSSKRESKTRLEISNPIPIKV      1 - 70
ASGSDLHLTDIDSDSNRGSVILDSGHLSTASSSDDLKGEEGSFRGSVLQRAAKFGSLAKQNSQMIVKRFS     71 - 140
FSQRSRDESASETSTPSEHSAAPSPQVEVRTLEGQLVQHPGPGIPRPGHRSRAPELVTKKFPVDLRLPPV    141 - 210
VPLPPPTLRELELQRRPTGDFGFSLRRTTMLDRGPEGQACRRVVHFAEPGAGTKDLALGLVPGDRLVEIN    211 - 280
GHNVESKSRDEIVEMIRQSGDSVRLKVQPIPELSELSRSWLRSGEGPRREPSDAKTEEQIAAEEAWNETE    281 - 350
KVWLVHRDGFSLASQLKSEELNLPEGKVRVKLDHDGAILDVDEDDVEKANAPSCDRLEDLASLVYLNESS    351 - 420
VLHTLRQRYGASLLHTYAGPSLLVLGPRGAPAVYSEKVMHMFKGCRREDMAPHIYAVAQTAYRAMLMSRQ    421 - 490
DQSIILLGSSGSGKTTSCQHLVQYLATIAGISGNKVFSVEKWQALYTLLEAFGNSPTIINGNATRFSQIL    491 - 560
SLDFDQAGQVASASIQTMLLEKLRVARRPASEATFNVFYYLLACGDGTLRTELHLNHLAENNVFGIVPLA    561 - 630
KPEEKQKAAQQFSKLQAAMKVLGISPDEQKACWFILAAIYHLGAAGATKEAAEAGRKQFARHEWAQKAAY    631 - 700
LLGCSLEELSSAIFKHQHKGGTLQRSTSFRQGPEESGLGDGTGPKLSALECLEGMAAGLYSELFTLLVSL    701 - 770
VNRALKSSQHSLCSMMIVDTPGFQNPEQGGSARGASFEELCHNYTQDRLQRLFHERTFVQELERYKEENI    771 - 840
ELAFDDLEPPTDDSVAAVDQASHQSLVRSLARTDEARGLLWLLEEEALVPGASEDTLLERLFSYYGPQEG    841 - 910
DKKGQSPLLHSSKPHHFLLGHSHGTNWVEYNVTGWLNYTKQNPATQNAPRLLQDSQKKIISNLFLGRAGS    911 - 980
ATVLSGSIAGLEGGSQLALRRATSMRKTFTTGMAAVKKKSLCIQMKLQVDALIDTIKKSKLHFVHCFLPV    981 - 1050
AEGWAGEPRSASSRRVSSSSELDLPSGDHCEAGLLQLDVPLLRTQLRGSRLLDAMRMYRQGYPDHMVFSE   1051 - 1120
FRRRFDVLAPHLTKKHGRNYIVVDERRAVEELLECLDLEKSSCCMGLSRVFFRAGTLARLEEQRDEQTSR   1121 - 1190
NLTLFQAACRGYLARQHFKKRKIQDLAIRCVQKNIKKNKGVKDWPWWKLFTTVRPLIEVQLSEEQIRNKD   1191 - 1260
EEIQQLRSKLEKAEKERNELRLNSDRLESRISELTSELTDERNTGESASQLLDAETAERLRAEKEMKELQ   1261 - 1330
TQYDALKKQMEVMEMEVMEARLIRAAEINGEVDDDDAGGEWRLKYERAVREVDFTKKRLQQEFEDKLEVE   1331 - 1400
QQNKRQLERRLGDLQADSEESQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDSELSQA   1401 - 1470
HEEAQREKLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAELQDISSQESKDEASLAKV   1471 - 1540
KKQLRDLEAKVKDQEEELDEQAGTIQMLEQAKLRLEMEMERMRQTHSKEMESRDEEVEEARQSCQKKLKQ   1541 - 1610
MEVQLEEEYEDKQKVLREKRELEGKLATLSDQVNRRDFESEKRLRKDLKRTKALLADAQLMLDHLKNSAP   1611 - 1680
SKREIAQLKNQLEESEFTCAAAVKARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEE   1681 - 1750
DQEDMNELMKKHKAAVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQ   1751 - 1820
EAKIRELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKRLQRQLRDTKEEMGEL   1821 - 1890
ARKEAEASRKKHELEMDLESLEAANQSLQADLKLAFKRIGDLQAAIEDEMESDENEDLINSLQDMVTKYQ   1891 - 1960
KRKNKLEGDSDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNT   1961 - 2030
SRPRYSHSYLSDSDTEAKLTETNA                                                 2031 - 2054
//

Text Mined References (45)

PMID Year Title
27708138 2016 GOLPH3 drives cell migration by promoting Golgi reorientation and directional trafficking to the leading edge.
26670045 2015 Specific Myosins Control Actin Organization, Cell Morphology, and Migration in Prostate Cancer Cells.
26500484 2015 The GOLPH3 pathway regulates Golgi shape and function and is activated by DNA damage.
25965346 2015 SP-R210 (Myo18A) Isoforms as Intrinsic Modulators of Macrophage Priming and Activation.
25754640 2015 Myosin 18A coassembles with nonmuscle myosin 2 to form mixed bipolar filaments.
25014165 2014 Binding of the extreme carboxyl-terminus of PAK-interacting exchange factor ? (?PIX) to myosin 18A (MYO18A) is required for epithelial cell migration.
24485452 2014 DNA damage triggers Golgi dispersal via DNA-PK and GOLPH3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23990465 2013 Functional characterization of human myosin-18A and its interaction with F-actin and GOLPH3.
23345592 2013 GOLPH3L antagonizes GOLPH3 to determine Golgi morphology.
More...