Property Summary

NCBI Gene PubMed Count 31
Grant Count 30
R01 Count 28
Funding $4,357,929.31
PubMed Score 52.48
PubTator Score 46.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.331 0.000
pancreatic ductal adenocarcinoma liver m... -2.106 0.001
lung cancer -1.700 0.000
lung carcinoma -1.100 0.000

Gene RIF (19)

PMID Text
25132672 Endoplasmic reticulum degradation-enhancing alpha-mannosidase-like protein 1 targets misfolded HLA-B27 dimers for endoplasmic reticulum-associated degradation.
24913918 miR-581 promotes hepatitis B virus surface antigen expression by targeting Dicer and EDEM1 in HepG2 cells.
24664425 EDEM1 colocalizes with the selective autophagy cargo receptors p62/SQSTM1, neighbor of BRCA1 gene 1 (NBR1) and autophagy-linked FYVE (Alfy) protein, and becomes engulfed by autophagic isolation membranes.
24037343 EDEM1 associates with lifespan in animal models, although not humans.
23233672 analysis of a shared endoplasmic reticulum-associated degradation pathway involving the EDEM1 protein for glycosylated and nonglycosylated proteins
22905195 Tyrosinase degradation is prevented when EDEM1 lacks the intrinsically disordered region
21917589 we suggest that a nascent glycoprotein can normally dissociate from EDEM1 and be rescued from endoplasmic reticulum associated degradation by reentering calnexin-refolding cycles
21632540 signal sequence cleavage functionally regulated the association of EDEM1-soluble and membrane-integrated isoforms with distinct ERAD machinery and substrates.
21388347 EDEM1 protein recognition may be determined by the structure of the endoplasmic reticulum-associated protein degradation substrate in a study of mutant ricin A-chain transport to the cytosol.
21062743 mannose trimming enables delivery of a substrate glycoprotein from EDEM1 to late endoplasmic reticulum degredation steps through association with XTP3-B
More...

AA Sequence

MQWRALVLGLVLLRLGLHGVLWLVFGLGPSMGFYQRFPLSFGFQRLRSPDGPASPTSGPVGRPGGVSGPS      1 - 70
WLQPPGTGAAQSPRKAPRRPGPGMCGPANWGYVLGGRGRGPDEYEKRYSGAFPPQLRAQMRDLARGMFVF     71 - 140
GYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAIMGNSSEFQKAVKLVI    141 - 210
NTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKT    211 - 280
GIPYPRVNLKTGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV    281 - 350
VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLY    351 - 420
VNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQLQAPDVLFYPL    421 - 490
RPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSTEDRMESFFLSETCKYLYL    491 - 560
LFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCN    561 - 630
RVPDERRYSLPLKSIYMRQIDQMVGLI                                               631 - 657
//

Text Mined References (33)

PMID Year Title
25132672 2014 Endoplasmic reticulum degradation-enhancing ?-mannosidase-like protein 1 targets misfolded HLA-B27 dimers for endoplasmic reticulum-associated degradation.
25092655 2014 EDEM2 initiates mammalian glycoprotein ERAD by catalyzing the first mannose trimming step.
24913918 2014 MicroRNA-581 promotes hepatitis B virus surface antigen expression by targeting Dicer and EDEM1.
24664425 2014 ERADication of EDEM1 occurs by selective autophagy and requires deglycosylation by cytoplasmic peptide N-glycanase.
24200403 2014 The role of EDEM2 compared with EDEM1 in ricin transport from the endoplasmic reticulum to the cytosol.
24037343 2014 Identification of genes promoting skin youthfulness by genome-wide association study.
23233672 2013 A shared endoplasmic reticulum-associated degradation pathway involving the EDEM1 protein for glycosylated and nonglycosylated proteins.
22905195 2012 Tyrosinase degradation is prevented when EDEM1 lacks the intrinsically disordered region.
21917589 2011 Bypass of glycan-dependent glycoprotein delivery to ERAD by up-regulated EDEM1.
21632540 2011 Characterization of early EDEM1 protein maturation events and their functional implications.
More...