Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.19
PubTator Score 7.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Weight Gain 87
Disease Target Count P-value
pilocytic astrocytoma 3086 4.70736098101745E-9
pediatric high grade glioma 2712 8.7712060541575E-9
atypical teratoid / rhabdoid tumor 4369 1.00326063329371E-8
glioblastoma 5572 2.30558681889465E-7
ovarian cancer 8492 9.19672743125425E-7
medulloblastoma 1524 1.20218856615152E-6
ulcerative colitis 2087 1.00515924299827E-5
osteosarcoma 7933 1.23914325982877E-5
medulloblastoma, large-cell 6234 0.00207623134762379
primitive neuroectodermal tumor 3031 0.00351833599176985
inflammatory breast cancer 404 0.00370848419925237
subependymal giant cell astrocytoma 2287 0.00616124504293258
astrocytic glioma 2241 0.00783995032910056
ependymoma 2514 0.0150966615279146
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.015114846221013
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0168075077995444
active Crohn's disease 918 0.0173780486966869
gastric carcinoma 832 0.0182592578301082
Pick disease 1893 0.0206722984392844
oligodendroglioma 2849 0.0273916106213173
Disease Target Count Z-score Confidence
Short bowel syndrome 16 3.554 1.8

Expression

Synonym

Accession Q92604 Q53YL2
Symbols NET8
FAM34A
FAM34A1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (2)

PMID Text
23505186 LPGAT1 is a novel gene that influences BMI in Native Americans.
15485873 human LPGAT1 is an endoplasmic reticulum-associated lysophosphatidylglycerol acyltransferase

AA Sequence

MAITLEEAPWLGWLLVKALMRFAFMVVNNLVAIPSYICYVIILQPLRVLDSKRFWYIEGIMYKWLLGMVA      1 - 70
SWGWYAGYTVMEWGEDIKAVSKDEAVMLVNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIV     71 - 140
SLVHGDFFIRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNV    141 - 210
TLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVT    211 - 280
HVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMTLSNLWIFLIQSF    281 - 350
AFLSGYMWYNIIQYFYHCLF                                                      351 - 370
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23505186 2013 Evidence for a role of LPGAT1 in influencing BMI and percent body fat in Native Americans.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
19946888 2010 Defining the membrane proteome of NK cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485873 2004 Identification and characterization of a gene encoding human LPGAT1, an endoplasmic reticulum-associated lysophosphatidylglycerol acyltransferase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
9637538 1998 An antigen recognized by autologous CTLs on a human bladder carcinoma.
More...