Property Summary

NCBI Gene PubMed Count 10
Grant Count 6
Funding $1,186,067.31
PubMed Score 12.19
PubTator Score 7.29

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92604 Q53YL2
Symbols NET8
FAM34A
FAM34A1

Gene

Gene RIF (2)

PMID Text
23505186 LPGAT1 is a novel gene that influences BMI in Native Americans.
15485873 human LPGAT1 is an endoplasmic reticulum-associated lysophosphatidylglycerol acyltransferase

AA Sequence

MAITLEEAPWLGWLLVKALMRFAFMVVNNLVAIPSYICYVIILQPLRVLDSKRFWYIEGIMYKWLLGMVA      1 - 70
SWGWYAGYTVMEWGEDIKAVSKDEAVMLVNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIV     71 - 140
SLVHGDFFIRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNV    141 - 210
TLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVT    211 - 280
HVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMTLSNLWIFLIQSF    281 - 350
AFLSGYMWYNIIQYFYHCLF                                                      351 - 370
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23505186 2013 Evidence for a role of LPGAT1 in influencing BMI and percent body fat in Native Americans.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
19946888 2010 Defining the membrane proteome of NK cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485873 2004 Identification and characterization of a gene encoding human LPGAT1, an endoplasmic reticulum-associated lysophosphatidylglycerol acyltransferase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
9637538 1998 An antigen recognized by autologous CTLs on a human bladder carcinoma.
More...