Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.21
PubTator Score 7.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.622 1.7e-02
adult high grade glioma -1.100 2.9e-03
astrocytic glioma -1.200 1.2e-03
Astrocytoma, Pilocytic -1.300 4.0e-05
atypical teratoid / rhabdoid tumor -2.100 1.0e-08
ependymoma -1.200 4.6e-03
gastric carcinoma 1.300 1.8e-02
glioblastoma -1.400 1.7e-07
group 4 medulloblastoma -1.600 3.7e-05
inflammatory breast cancer 1.100 3.7e-03
intraductal papillary-mucinous carcinoma... 1.400 1.5e-02
medulloblastoma, large-cell -1.100 2.1e-03
oligodendroglioma -1.800 2.7e-02
osteosarcoma -1.516 1.2e-05
ovarian cancer -1.200 1.8e-05
pancreatic ductal adenocarcinoma liver m... -1.168 1.7e-02
Pick disease 1.100 2.1e-02
primitive neuroectodermal tumor -1.200 3.5e-03
subependymal giant cell astrocytoma -1.196 6.2e-03
ulcerative colitis 2.200 1.0e-05

Gene RIF (2)

AA Sequence

MAITLEEAPWLGWLLVKALMRFAFMVVNNLVAIPSYICYVIILQPLRVLDSKRFWYIEGIMYKWLLGMVA      1 - 70
SWGWYAGYTVMEWGEDIKAVSKDEAVMLVNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIV     71 - 140
SLVHGDFFIRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNV    141 - 210
TLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVT    211 - 280
HVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMTLSNLWIFLIQSF    281 - 350
AFLSGYMWYNIIQYFYHCLF                                                      351 - 370
//

Text Mined References (12)

PMID Year Title