Property Summary

NCBI Gene PubMed Count 115
Grant Count 121
R01 Count 50
Funding $15,217,150.73
PubMed Score 455.43
PubTator Score 273.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 0.000

Synonym

Accession Q92583 A0N0Q9 Q2M287
Symbols TARC
ABCD-2
SCYA17
A-152E5.3

Gene

PDB

1NR2   1NR4  

Gene RIF (97)

PMID Text
26781124 CCL17 positively regulates the tumorigenesis of hepatocellular carcinoma.Higher levels of intratumoral CCL17 expression are associated with poorer survival of hepatocellular carcinoma patients.
26182268 The SNP rs223895 in TARC/CCL17 gene is associated with the susceptibility to Kawasaki disease.
25555269 Serum CCL17 levels are associated with coronary artery disease and atherosclerosis severity independently of traditional cardiovascular risk factors.
25412496 CCL17 and CCL18 dermal expression is associated with leprosy polarity.
25268342 The serum TARC level is a very sensitive biomarker for monitoring the severity and treatment response in AD
25240818 TARC was correlated with disease status and its monitoring may be able to predict PET positivity after alloSCT, thus potentially allowing an early immune manipulation.
25199679 Serum TARC may represent a suitable biomarker for monitoring of atopic dermatitis severity in daily practice.
25062565 Serum levels of CCL17 were positively correlated with coronary artery disease.
25013801 High CXCL10 levels were detected in acutely infected children regardless of virus pathogen, whereas increased CCL17 production was RSV-specific
24984931 TARC and interleukin-31 may be biomarkers for adult atopic dermatitis
More...

AA Sequence

MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGR      1 - 70
AICSDPNNKRVKNAVKYLQSLERS                                                   71 - 94
//

Text Mined References (115)

PMID Year Title
26781124 2016 Tumor-associated macrophage or chemokine ligand CCL17 positively regulates the tumorigenesis of hepatocellular carcinoma.
26182268 2015 [Association of single nucleotide polymorphisms in TARC/CCL17 gene with Kawasaki disease and its clinical characteristics].
25555269 2015 Serum chemokine CCL17/thymus activation and regulated chemokine is correlated with coronary artery diseases.
25412496 2014 Differential dermal expression of CCL17 and CCL18 in tuberculoid and lepromatous leprosy.
25268342 2014 Reduction of serum TARC levels in atopic dermatitis by topical anti-inflammatory treatments.
25240818 2014 Serum thymus and activation-regulated chemokine level monitoring may predict disease relapse detected by PET scan after reduced-intensity allogeneic stem cell transplantation in patients with Hodgkin lymphoma.
25199679 2014 Utility of serum thymus and activation-regulated chemokine as a biomarker for monitoring of atopic dermatitis severity.
25062565 2014 Association between serum chemokine CC-motif ligand 17 and coronary artery disease.
25013801 2014 The increased type-1 and type-2 chemokine levels in children with acute RSV infection alter the development of adaptive immune responses.
24984931 2014 Serum thymus and activation-regulated chemokine (TARC) and interleukin-31 levels as biomarkers for monitoring in adult atopic dermatitis.
More...