Property Summary

NCBI Gene PubMed Count 127
PubMed Score 488.96
PubTator Score 273.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 1.6e-13

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (109)

AA Sequence

MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGR      1 - 70
AICSDPNNKRVKNAVKYLQSLERS                                                   71 - 94
//

Text Mined References (127)

PMID Year Title