Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.43
PubTator Score 5.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Menkes disease 19 3.313 1.7

Expression

Gene RIF (6)

AA Sequence

MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYAT      1 - 70
LYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQ     71 - 140
IDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK                     141 - 193
//

Text Mined References (19)

PMID Year Title