Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.24
PubTator Score 5.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Menkes disease 20 3.338 1.7

Expression

Synonym

Accession Q92572 O00647 O00676 O00721 O00727 Q53XL4 Q6ICQ2
Symbols CLAPS3
Sigma3A

Gene

Gene RIF (11)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify adaptor-related protein complex 3 sigma 1 subunit (AP3S1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify adaptor-related protein complex 3 sigma 1 subunit (AP3S1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify adaptor-related protein complex 3 sigma 1 subunit (AP3S1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify adaptor-related protein complex 3 sigma 1 subunit (AP3S1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22875976 Tandem affinity purification and mass spectrometry analysis identify adaptor-related protein complex 3 sigma 1 subunit (AP3S1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20512086 KCNQ and AP3S1, but not MAN2A1 or ALDH7A1 have a role in risk of type 2 diabetes in the Chinese Northern Han population
20512086 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18076669 Tandem affinity purification and mass spectrometry analysis identify adaptor-related protein complex 3 sigma 1 subunit (AP3S1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
18076669 Tandem affinity purification and mass spectrometry analysis identify adaptor-related protein complex 3 sigma 1 subunit (AP3S1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
More...

AA Sequence

MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYAT      1 - 70
LYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQ     71 - 140
IDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK                     141 - 193
//

Text Mined References (19)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20512086 2010 Variants in KCNQ1, AP3S1, MAN2A1, and ALDH7A1 and the risk of type 2 diabetes in the Chinese Northern Han population: a case-control study and meta-analysis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17125464 2006 Downregulation of genes encoding for subunits of adaptor complex-3 in cervical carcinomas.
16162817 2005 Functions of adaptor protein (AP)-3 and AP-1 in tyrosinase sorting from endosomes to melanosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469849 2004 An ear-core interaction regulates the recruitment of the AP-3 complex to membranes.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...