Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.94
PubTator Score 1.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Brachydactyly 156 3.104 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.600 1.8e-02
glioblastoma 1.700 5.9e-03
lung cancer -1.800 5.0e-04
malignant mesothelioma -2.100 1.7e-07
ovarian cancer 2.000 1.2e-05
pancreatic cancer 1.100 3.2e-03
primary pancreatic ductal adenocarcinoma 1.055 1.1e-02

Gene RIF (3)

AA Sequence

MCHGRIAPKSTSVFAVASVGHGVFLPLVILCTLLGDGLASVCPLPPEPENGGYICHPRPCRDPLTAGSVI      1 - 70
EYLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLSIVASTASSVALILLLVVLFV     71 - 140
LLQPKLKSFHHSRRDQGVSGDQVSIMVDGVQVALPSYEEAVYGSSGHCVPPADPRVQIVLSEGSGPSGRS    141 - 210
VPREQQLPDQGACSSAGGEDEAPGQSGLCEAWGSRASETVMVHQATTSSWVAGSGNRQLAHKETADSENS    211 - 280
DIQSLLSLTSEEYTDDIPLLKEA                                                   281 - 303
//

Text Mined References (8)

PMID Year Title