Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.61
PubTator Score 1.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
astrocytoma 1.600 0.018
glioblastoma 1.700 0.006
primary pancreatic ductal adenocarcinoma 1.055 0.011
lung cancer -1.800 0.000
ovarian cancer 2.000 0.000
pancreatic cancer 1.100 0.003

Gene RIF (3)

PMID Text
24652652 DRAGO (drug-activated gene overexpressed) KIAA0247 represents a new p53-dependent gene highly regulated in human cells and whose expression cooperates with p53 in tumor suppressor functions.
21619678 This is the first description of a linkage between KIAA0247 and colorectal cancer.
20236627 gene silencing in umbilical vein endothelial cells causes decrease in monocyte chemoattractant protein-1 production during endotoxemia

AA Sequence

MCHGRIAPKSTSVFAVASVGHGVFLPLVILCTLLGDGLASVCPLPPEPENGGYICHPRPCRDPLTAGSVI      1 - 70
EYLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLSIVASTASSVALILLLVVLFV     71 - 140
LLQPKLKSFHHSRRDQGVSGDQVSIMVDGVQVALPSYEEAVYGSSGHCVPPADPRVQIVLSEGSGPSGRS    141 - 210
VPREQQLPDQGACSSAGGEDEAPGQSGLCEAWGSRASETVMVHQATTSSWVAGSGNRQLAHKETADSENS    211 - 280
DIQSLLSLTSEEYTDDIPLLKEA                                                   281 - 303
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24652652 2014 DRAGO (KIAA0247), a new DNA damage-responsive, p53-inducible gene that cooperates with p53 as oncosuppressor. [Corrected].
21619678 2011 A predicted protein, KIAA0247, is a cell cycle modulator in colorectal cancer cells under 5-FU treatment.
20236627 2010 Characterization of SVEP1, KIAA, and SRPX2 in an in vitro cell culture model of endotoxemia.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.