Property Summary

NCBI Gene PubMed Count 42
Grant Count 30
R01 Count 19
Funding $7,325,150.84
PubMed Score 86.62
PubTator Score 49.65

Knowledge Summary

Patent (1,551)

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -2.000 0.000

Gene RIF (26)

PMID Text
26963637 When the "split protein" is coexpressed, the parts associate to form a normal channel.
26646186 Piezo1 responds to lateral membrane tension with exquisite sensitivity as compared to other mechanically activated channels and that resting tension can drive channel inactivation, thereby tuning overall mechanical sensitivity of Piezo1.
26387913 Mutations in PIEZO1 is associated with persistent lymphoedema caused by congenital lymphatic dysplasia.
26351678 Piezo1 channels are likely to function in normal RBCs and suggest a previously unidentified mechanotransductive pathway in ATP release.
26333996 Homozygous and compound heterozygous mutations in PIEZO1, result in an autosomal recessive form of generalized lymphatic dysplasia with a high incidence of non-immune hydrops fetalis and childhood onset of facial and four limb lymphoedema.
26001275 Piezo1 is amenable to chemical activation and thus there is a possibility that endogenous Piezo1 agonists might exist.
26001274 Mechanically activated Piezo1 plays an essential role in red blood cell volume homeostasis.
25955826 PIEZO1 is permeable to monovalent ions (K+, Na+, Cs+, Li+) and most divalent ions (Ba2+, Ca2+ and Mg2+), but not to Mn2+.
25666479 a possible role of Piezo1 in invasion and metastatic propagation.
25561736 Protonation of the human PIEZO1 ion channel stabilizes inactivation.
More...

AA Sequence

MEPHVLGAVLYWLLLPCALLAACLLRFSGLSLVYLLFLLLLPWFPGPTRCGLQGHTGRLLRALLGLSLLF      1 - 70
LVAHLALQICLHIVPRLDQLLGPSCSRWETLSRHIGVTRLDLKDIPNAIRLVAPDLGILVVSSVCLGICG     71 - 140
RLARNTRQSPHPRELDDDERDVDASPTAGLQEAATLAPTRRSRLAARFRVTAHWLLVAAGRVLAVTLLAL    141 - 210
AGIAHPSALSSVYLLLFLALCTWWACHFPISTRGFSRLCVAVGCFGAGHLICLYCYQMPLAQALLPPAGI    211 - 280
WARVLGLKDFVGPTNCSSPHALVLNTGLDWPVYASPGVLLLLCYATASLRKLRAYRPSGQRKEAAKGYEA    281 - 350
RELELAELDQWPQERESDQHVVPTAPDTEADNCIVHELTGQSSVLRRPVRPKRAEPREASPLHSLGHLIM    351 - 420
DQSYVCALIAMMVWSITYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGMTLCCLRYVWAMDLRP    421 - 490
ELPTTLGPVSLRQLGLEHTRYPCLDLGAMLLYTLTFWLLLRQFVKEKLLKWAESPAALTEVTVADTEPTR    491 - 560
TQTLLQSLGELVKGVYAKYWIYVCAGMFIVVSFAGRLVVYKIVYMFLFLLCLTLFQVYYSLWRKLLKAFW    561 - 630
WLVVAYTMLVLIAVYTFQFQDFPAYWRNLTGFTDEQLGDLGLEQFSVSELFSSILVPGFFLLACILQLHY    631 - 700
FHRPFMQLTDMEHVSLPGTRLPRWAHRQDAVSGTPLLREEQQEHQQQQQEEEEEEEDSRDEGLGVATPHQ    701 - 770
ATQVPEGAAKWGLVAERLLELAAGFSDVLSRVQVFLRRLLELHVFKLVALYTVWVALKEVSVMNLLLVVL    771 - 840
WAFALPYPRFRPMASCLSTVWTCVIIVCKMLYQLKVVNPQEYSSNCTEPFPNSTNLLPTEISQSLLYRGP    841 - 910
VDPANWFGVRKGFPNLGYIQNHLQVLLLLVFEAIVYRRQEHYRRQHQLAPLPAQAVFASGTRQQLDQDLL    911 - 980
GCLKYFINFFFYKFGLEICFLMAVNVIGQRMNFLVTLHGCWLVAILTRRHRQAIARLWPNYCLFLALFLL    981 - 1050
YQYLLCLGMPPALCIDYPWRWSRAVPMNSALIKWLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAER   1051 - 1120
TEEWQRMAGVNTDRLEPLRGEPNPVPNFIHCRSYLDMLKVAVFRYLFWLVLVVVFVTGATRISIFGLGYL   1121 - 1190
LACFYLLLFGTALLQRDTRARLVLWDCLILYNVTVIISKNMLSLLACVFVEQMQTGFCWVIQLFSLVCTV   1191 - 1260
KGYYDPKEMMDRDQDCLLPVEEAGIIWDSVCFFFLLLQRRVFLSHYYLHVRADLQATALLASRGFALYNA   1261 - 1330
ANLKSIDFHRRIEEKSLAQLKRQMERIRAKQEKHRQGRVDRSRPQDTLGPKDPGLEPGPDSPGGSSPPRR   1331 - 1400
QWWRPWLDHATVIHSGDYFLFESDSEEEEEAVPEDPRPSAQSAFQLAYQAWVTNAQAVLRRRQQEQEQAR   1401 - 1470
QEQAGQLPTGGGPSQEVEPAEGPEEAAAGRSHVVQRVLSTAQFLWMLGQALVDELTRWLQEFTRHHGTMS   1471 - 1540
DVLRAERYLLTQELLQGGEVHRGVLDQLYTSQAEATLPGPTEAPNAPSTVSSGLGAEEPLSSMTDDMGSP   1541 - 1610
LSTGYHTRSGSEEAVTDPGEREAGASLYQGLMRTASELLLDRRLRIPELEEAELFAEGQGRALRLLRAVY   1611 - 1680
QCVAAHSELLCYFIIILNHMVTASAGSLVLPVLVFLWAMLSIPRPSKRFWMTAIVFTEIAVVVKYLFQFG   1681 - 1750
FFPWNSHVVLRRYENKPYFPPRILGLEKTDGYIKYDLVQLMALFFHRSQLLCYGLWDHEEDSPSKEHDKS   1751 - 1820
GEEEQGAEEGPGVPAATTEDHIQVEARVGPTDGTPEPQVELRPRDTRRISLRFRRRKKEGPARKGAAAIE   1821 - 1890
AEDREEEEGEEEKEAPTGREKRPSRSGGRVRAAGRRLQGFCLSLAQGTYRPLRRFFHDILHTKYRAATDV   1891 - 1960
YALMFLADVVDFIIIIFGFWAFGKHSAATDITSSLSDDQVPEAFLVMLLIQFSTMVVDRALYLRKTVLGK   1961 - 2030
LAFQVALVLAIHLWMFFILPAVTERMFNQNVVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNH   2031 - 2100
LNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSSWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKI   2101 - 2170
VKYGMGGLIILFLIAIIWFPLLFMSLVRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAY   2171 - 2240
EELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRD   2241 - 2310
LAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEA   2311 - 2380
DYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKVSPPSLGFLAGYGIMGLYVSIVLV   2381 - 2450
IGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTREK   2451 - 2520
E//

Text Mined References (52)

PMID Year Title
26963637 2016 Human PIEZO1 Ion Channel Functions as a Split Protein.
26646186 2015 Mechanical sensitivity of Piezo1 ion channels can be tuned by cellular membrane tension.
26387913 2015 Impaired PIEZO1 function in patients with a novel autosomal recessive congenital lymphatic dysplasia.
26351678 2015 Piezo1 regulates mechanotransductive release of ATP from human RBCs.
26333996 2015 Novel mutations in PIEZO1 cause an autosomal recessive generalized lymphatic dysplasia with non-immune hydrops fetalis.
26001275 2015 Chemical activation of the mechanotransduction channel Piezo1.
26001274 2015 Piezo1 links mechanical forces to red blood cell volume.
25955826 2015 Ionic Selectivity and Permeation Properties of Human PIEZO1 Channels.
25927085 2015 Dehydrated hereditary stomatocytosis masquerading as MDS.
25666479 2015 Piezo1 forms mechanosensitive ion channels in the human MCF-7 breast cancer cell line.
More...