Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.35
PubTator Score 2.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung carcinoma 413 4.52923808293663E-17
ovarian cancer 8492 1.59363633252427E-11
ulcerative colitis 2087 3.04382437229365E-7
lung adenocarcinoma 2714 5.06366308393979E-5
medulloblastoma, large-cell 6234 9.83930272098788E-5
osteosarcoma 7933 4.21214759370011E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0355323736486376
Disease Target Count Z-score Confidence
Refractive error 43 0.0 1.0

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.194 0.000
medulloblastoma, large-cell 1.400 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.036
lung adenocarcinoma 1.348 0.000
non-small cell lung carcinoma 1.300 0.000
ulcerative colitis -1.400 0.000
ovarian cancer 1.700 0.000

Synonym

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 IMPC Term (1)

 GWAS Trait (1)

Pathway (1)

AA Sequence

MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGSQPVPDAGPWGDYLCDSPWAL      1 - 70
INSSIYAMKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDFHPK     71 - 140
NQFPAGSNNIYNQIAELWKPWLSNESIALFKKGAFYCEKLPGPSGAGRIVVLNTNLYYTSNALTADMADP    141 - 210
GQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKAWFREGFNEKYLKVVRKHHRVIAGQFFGHHHT    211 - 280
DSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKDMVTYFMNLSQANAQ    281 - 350
GTPRWELEYQLTEAYGVPDASAHSMHTVLDRIAGDQSTLQRYYVYNSVSYSAGVCDEACSMQHVCAMRQV    351 - 420
DIDAYTTCLYASGTTPVPQLPLLLMALLGLCTLVL                                       421 - 455
//

Text Mined References (10)

PMID Year Title
26095358 2015 The Lipid-Modifying Enzyme SMPDL3B Negatively Regulates Innate Immunity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23322567 2013 Identification of a candidate gene for astigmatism.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.