Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.60
PubTator Score 2.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Refractive error 50 0.0 1.4
Disease Target Count Z-score Confidence
Kidney disease 430 3.221 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.100 3.6e-02
lung adenocarcinoma 1.200 8.1e-09
medulloblastoma, large-cell 1.400 9.8e-05
non-small cell lung carcinoma 1.300 4.5e-17
osteosarcoma 1.194 4.2e-04
ovarian cancer 1.700 1.6e-11
ulcerative colitis -1.400 3.0e-07

Gene RIF (1)

AA Sequence

MRLLAWLIFLANWGGARAEPGKFWHIADLHLDPDYKVSKDPFQVCPSAGSQPVPDAGPWGDYLCDSPWAL      1 - 70
INSSIYAMKEIEPEPDFILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDFHPK     71 - 140
NQFPAGSNNIYNQIAELWKPWLSNESIALFKKGAFYCEKLPGPSGAGRIVVLNTNLYYTSNALTADMADP    141 - 210
GQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKAWFREGFNEKYLKVVRKHHRVIAGQFFGHHHT    211 - 280
DSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKDMVTYFMNLSQANAQ    281 - 350
GTPRWELEYQLTEAYGVPDASAHSMHTVLDRIAGDQSTLQRYYVYNSVSYSAGVCDEACSMQHVCAMRQV    351 - 420
DIDAYTTCLYASGTTPVPQLPLLLMALLGLCTLVL                                       421 - 455
//

Text Mined References (11)

PMID Year Title