Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.98
PubTator Score 4.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (12)

Disease log2 FC p
colon cancer -2.000 3.5e-04
cystic fibrosis 1.528 7.5e-05
glioblastoma 1.300 2.5e-02
interstitial cystitis 1.700 9.8e-06
lung cancer -1.300 5.4e-03
malignant mesothelioma -2.100 8.9e-08
medulloblastoma, large-cell -1.700 4.8e-03
ovarian cancer -1.800 2.5e-09
pancreatic ductal adenocarcinoma liver m... -2.019 5.8e-03
pituitary cancer -1.400 2.9e-03
tuberculosis -1.200 1.3e-03
ulcerative colitis -1.500 1.1e-05

Gene RIF (6)

AA Sequence

MALVRALVCCLLTAWHCRSGLGLPVAPAGGRNPPPAIGQFWHVTDLHLDPTYHITDDHTKVCASSKGANA      1 - 70
SNPGPFGDVLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTDTVINVITNMTTTIQSLF     71 - 140
PNLQVFPALGNHDYWPQDQLPVVTSKVYNAVANLWKPWLDEEAISTLRKGGFYSQKVTTNPNLRIISLNT    141 - 210
NLYYGPNIMTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHVPVGYLPSSQNITAMREYYNEKLIDIFQ    211 - 280
KYSDVIAGQFYGHTHRDSIMVLSDKKGSPVNSLFVAPAVTPVKSVLEKQTNNPGIRLFQYDPRDYKLLDM    281 - 350
LQYYLNLTEANLKGESIWKLEYILTQTYDIEDLQPESLYGLAKQFTILDSKQFIKYYNYFFVSYDSSVTC    351 - 420
DKTCKAFQICAIMNLDNISYADCLKQLYIKHNY                                         421 - 453
//

Text Mined References (13)

PMID Year Title