Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.92
PubTator Score 5.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Lung squamous cell carcinoma 10 3.059 1.5

Expression

Gene RIF (1)

PMID Text
11979432 is downregulated and degraded during retinoid-induced apoptosis

AA Sequence

MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQP      1 - 70
RGWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFP     71 - 140
LPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPA    141 - 210
AAPQRQAYLKFLDQFAE                                                         211 - 227
//

Text Mined References (11)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16368187 2006 Mass spectrometric identification of serine hydrolase OVCA2 in the medulloblastoma cell line DAOY.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11979432 2002 OVCA2 is downregulated and degraded during retinoid-induced apoptosis.
More...