Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.92
PubTator Score 5.78

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WZ82 Q86XN3 Q8IW87 Q9UCX9
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQP      1 - 70
RGWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFP     71 - 140
LPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPA    141 - 210
AAPQRQAYLKFLDQFAE                                                         211 - 227
//

Text Mined References (12)

PMID Year Title