Property Summary

NCBI Gene PubMed Count 11
PubMed Score 30.90
PubTator Score 9.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2890 1.6e-10
non primary Sjogren syndrome sicca 891 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hepatitis C 94 0.0 0.9

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.700 1.8e-02
non-small cell lung cancer -1.537 1.6e-10

Gene RIF (5)

AA Sequence

MKQKMMARLLRTSFALLFLGLFGVLGAATISCRNEEGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTT      1 - 70
RSWRKSEQLMNDTKSVLGRTLQQLYEAYASKSNNTAYLIYNDGVPKPVNYSRKYGHTKGLLLWNRVQGFW     71 - 140
LIHSIPQFPPIPEEGYDYPPTGRRNGQSGICITFKYNQYEAIDSQLLVCNPNVYSCSIPATFHQELIHMP    141 - 210
QLCTRASSSEIPGRLLTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCS    211 - 280
LPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAF    281 - 350
QGLVLYYESCK                                                               351 - 361
//

Text Mined References (12)

PMID Year Title