Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
R01 Count 5
Funding $841,670
PubMed Score 31.15
PubTator Score 9.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer -1.537 0.000
non primary Sjogren syndrome sicca 1.700 0.018

Gene RIF (5)

PMID Text
23507146 HSF4 exerts its function on lens differentiation via positive regulation of DLAD expression.
21390259 These data identify DNase 2 as the predominant DNase on the mammalian skin surface and indicate that its activity is primarily targeted to exogenous DNA.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20201924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
11700027 gene lie head-to-head with the urate oxidase gene

AA Sequence

MKQKMMARLLRTSFALLFLGLFGVLGAATISCRNEEGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTT      1 - 70
RSWRKSEQLMNDTKSVLGRTLQQLYEAYASKSNNTAYLIYNDGVPKPVNYSRKYGHTKGLLLWNRVQGFW     71 - 140
LIHSIPQFPPIPEEGYDYPPTGRRNGQSGICITFKYNQYEAIDSQLLVCNPNVYSCSIPATFHQELIHMP    141 - 210
QLCTRASSSEIPGRLLTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCS    211 - 280
LPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAF    281 - 350
QGLVLYYESCK                                                               351 - 361
//

Text Mined References (12)

PMID Year Title
23507146 2013 HSF4 regulates DLAD expression and promotes lens de-nucleation.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22095909 2012 Serum ferritin levels are associated with a distinct phenotype of chronic hepatitis C poorly responding to pegylated interferon-alpha and ribavirin therapy.
21390259 2011 DNase 2 is the main DNA-degrading enzyme of the stratum corneum.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20201924 2010 Genome-wide association study of alcohol dependence implicates a region on chromosome 11.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12944971 2003 Nuclear cataract caused by a lack of DNA degradation in the mouse eye lens.
12594037 2003 A family history of deoxyribonuclease II: surprises from Trichinella spiralis and Burkholderia pseudomallei.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...