Property Summary

NCBI Gene PubMed Count 23
PubMed Score 4.16
PubTator Score 1.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.100 6.4e-03
Astrocytoma, Pilocytic 1.100 8.6e-05
chronic rhinosinusitis -1.272 3.9e-02
hepatocellular carcinoma 1.100 1.8e-04
interstitial cystitis 1.400 1.4e-03
interstitial lung disease 1.100 3.4e-02
invasive ductal carcinoma 1.408 6.0e-04
lung carcinoma -2.100 1.1e-24
nasopharyngeal carcinoma -1.300 1.9e-02
non-small cell lung cancer -1.403 3.8e-12
osteosarcoma -2.934 6.0e-08
periodontitis 1.800 5.7e-26
primary Sjogren syndrome 2.700 1.2e-04
tuberculosis -1.500 5.7e-04
ulcerative colitis 2.200 3.7e-05

Synonym

Accession Q8WZ60 B2RB31 D3DNS8 Q8N5I1 Q8N892
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MLMAGQRGAWTMGDVVEKSLEGPLAPSTDEPSQKTGDLVEILNGEKVKFDDAGLSLILQNGLETLRMENA      1 - 70
LTDVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRIIIKGVDAETMHTLLDYTYTSKALITKQ     71 - 140
NVQRVLEAANLFQFLRMVDACASFLTEALNPENCVGILRLADTHSLDSLKKQVQSYIIQNFVQILNSEEF    141 - 210
LDLPVDTLHHILKSDDLYVTEEAQVFETVMSWVRHKPSERLCLLPYVLENVRLPLLDPWYFVETVEADPL    211 - 280
IRQCPEVFPLLQEARMYHLSGNEIISERTKPRMHEFQSEVFMIIGGCTKDERFVAEVTCLDPLRRSRLEV    281 - 350
AKLPLTEHELESENKKWVEFACVTLKNEVYISGGKETQHDVWKYNSSINKWIQIEYLNIGRWRHKMVVLG    351 - 420
GKVYVIGGFDGLQRINNVETYDPFHNCWSEAAPLLVHVSSFAATSHKKKLYVIGGGPNGKLATDKTQCYD    421 - 490
PSTNKWSLKAAMPVEAKCINAVSFRDRIYVVGGAMRALYAYSPLEDSWCLVTQLSHERASCGIAPCNNRL    491 - 560
YITGGRDEKNEVIATVLCWDPEAQKLTEECVLPRGVSHHGSVTIRKSYTHIRRIVPGAVSV             561 - 621
//

Text Mined References (24)

PMID Year Title