Property Summary

NCBI Gene PubMed Count 26
PubMed Score 49.56
PubTator Score 29.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.1e-04
group 3 medulloblastoma -1.100 3.4e-03
invasive ductal carcinoma -1.200 1.2e-02
medulloblastoma, large-cell -2.300 1.9e-06
non-small cell lung cancer -1.342 3.3e-18
osteosarcoma 1.552 2.0e-03
Polycystic ovary syndrome -1.008 2.1e-03
tuberculosis 1.500 1.4e-04

Gene RIF (14)

AA Sequence

MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSELDE      1 - 70
EEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCI     71 - 140
VRTDSVKTPESEGNPLLEQLEKK                                                   141 - 163
//

Text Mined References (35)

PMID Year Title