Property Summary

NCBI Gene PubMed Count 25
Grant Count 19
R01 Count 19
Funding $1,489,786.1
PubMed Score 46.06
PubTator Score 29.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.552 0.002
group 4 medulloblastoma -1.600 0.000
atypical teratoid/rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -2.300 0.000
tuberculosis 1.500 0.000
non-small cell lung cancer -1.342 0.000
Polycystic Ovary Syndrome -1.008 0.002
invasive ductal carcinoma -1.200 0.012

Gene RIF (13)

PMID Text
24232097 Results suggest that JDP2 is an integral component of the Nrf2-MafK complex and that it modulates antioxidant and detoxification programs by acting via the ARE.
24120378 Preeclamptic plasma induces transcription modifications involving the AP-1 transcriptional regulator JDP2 in endothelial cells.
22989952 the recruitment of multiple HDAC members to JDP2 and ATF3 is part of their transcription repression mechanism.
21525011 JDP2 is crucial to triggering reactivation from latency to lytic replication
20950777 The molecular mechanisms that underlie the action of JDP2 in cellular aging and replicative senescence by mediating the dissociation of polycomb repressive complexes from the p16(Ink4a)/Arf locus are discussed.
20677166 JDP2 expression was downregulated in pancreatic carcinoma & this correlated with metastasis & decreased post-surgery survival.
20452405 3 SNPs (2 intronic: rs741846 & rs175646; & 1 in the untranslated region: rs8215) & their genotype distribution showed significant association in the Japanese & Korean but not Dutch intracranial aneurysm patients.
20452405 Observational study of gene-disease association. (HuGE Navigator)
19553667 A progesterone receptor co-activator (JDP2) mediates activity through interaction with residues in the carboxyl-terminal extension of the DNA binding domain.
18671972 IRF2-BP1 is a JDP2-binding protein enhancing the polyubiquitination of JDP2 and represses ATF2-mediated transcriptional activation from a CRE-containing promoter.
More...

AA Sequence

MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSELDE      1 - 70
EEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCI     71 - 140
VRTDSVKTPESEGNPLLEQLEKK                                                   141 - 163
//

Text Mined References (33)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24232097 2013 Jun dimerization protein 2 is a critical component of the Nrf2/MafK complex regulating the response to ROS homeostasis.
24120378 2013 Preeclamptic plasma induces transcription modifications involving the AP-1 transcriptional regulator JDP2 in endothelial cells.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22989952 The bZIP repressor proteins, c-Jun dimerization protein 2 and activating transcription factor 3, recruit multiple HDAC members to the ATF3 promoter.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
21525011 2011 Involvement of Jun dimerization protein 2 (JDP2) in the maintenance of Epstein-Barr virus latency.
20950777 2010 Histone chaperone Jun dimerization protein 2 (JDP2): role in cellular senescence and aging.
More...