Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.29
PubTator Score 1.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.09280614581591E-5
osteosarcoma 7933 0.00363753710525764
non primary Sjogren syndrome sicca 840 0.011817755740301
Disease Target Count Z-score Confidence
Microcephaly 149 3.286 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.406 0.004
non primary Sjogren syndrome sicca 1.500 0.012
ovarian cancer 1.400 0.000

Synonym

Accession Q8WY91 Q53NU7 Q6GRN0 Q6IPJ3 Q9NW26 Q9Y325
Symbols PP238
CGI-36

Gene

PDB

3IA8  

  Ortholog (8)

Species Source
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Cow EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard EggNOG Inparanoid
Xenopus EggNOG Inparanoid
Zebrafish OMA EggNOG

Pathway (1)

AA Sequence

MVICCAAVNCSNRQGKGEKRAVSFHRFPLKDSKRLIQWLKAVQRDNWTPTKYSFLCSEHFTKDSFSKRLE      1 - 70
DQHRLLKPTAVPSIFHLTEKKRGAGGHGRTRRKDASKATGGVRGHSSAATSRGAAGWSPSSSGNPMAKPE     71 - 140
SRRLKQAALQGEATPRAAQEAASQEQAQQALERTPGDGLATMVAGSQGKAEASATDAGDESATSSIEGGV    141 - 210
TDKSGISMDDFTPPGSGACKFIGSLHSYSFSSKHTRERPSVPREPIDRKRLKKDVEPSCSGSSLGPDKGL    211 - 280
AQSPPSSSLTATPQKPSQSPSAPPADVTPKPATEAVQSEHSDASPMSINEVILSASGACKLIDSLHSYCF    281 - 350
SSRQNKSQVCCLREQVEKKNGELKSLRQRVSRSDSQVRKLQEKLDELRRVSVPYPSSLLSPSREPPKMNP    351 - 420
VVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRECGFIRLKP    421 - 490
DTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHSIARISFAKEPHVEQITRKFRLNSEGKLEQTVSMATT    491 - 560
TQPMTQHLHVTYKKVTP                                                         561 - 577
//

Text Mined References (13)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21387410 2011 Structure of the C-terminal heme-binding domain of THAP domain containing protein 4 from Homo sapiens.
20171287 2010 Voxelwise genome-wide association study (vGWAS).
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12575992 2003 The THAP domain: a novel protein motif with similarity to the DNA-binding domain of P element transposase.
More...