Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.29
PubTator Score 1.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.1e-05
osteosarcoma 7950 3.6e-03
non primary Sjogren syndrome sicca 891 1.2e-02
Disease Target Count Z-score Confidence
Microcephaly 166 3.261 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.500 1.2e-02
osteosarcoma -1.406 3.6e-03
ovarian cancer 1.400 1.1e-05

AA Sequence

MVICCAAVNCSNRQGKGEKRAVSFHRFPLKDSKRLIQWLKAVQRDNWTPTKYSFLCSEHFTKDSFSKRLE      1 - 70
DQHRLLKPTAVPSIFHLTEKKRGAGGHGRTRRKDASKATGGVRGHSSAATSRGAAGWSPSSSGNPMAKPE     71 - 140
SRRLKQAALQGEATPRAAQEAASQEQAQQALERTPGDGLATMVAGSQGKAEASATDAGDESATSSIEGGV    141 - 210
TDKSGISMDDFTPPGSGACKFIGSLHSYSFSSKHTRERPSVPREPIDRKRLKKDVEPSCSGSSLGPDKGL    211 - 280
AQSPPSSSLTATPQKPSQSPSAPPADVTPKPATEAVQSEHSDASPMSINEVILSASGACKLIDSLHSYCF    281 - 350
SSRQNKSQVCCLREQVEKKNGELKSLRQRVSRSDSQVRKLQEKLDELRRVSVPYPSSLLSPSREPPKMNP    351 - 420
VVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRECGFIRLKP    421 - 490
DTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHSIARISFAKEPHVEQITRKFRLNSEGKLEQTVSMATT    491 - 560
TQPMTQHLHVTYKKVTP                                                         561 - 577
//

Text Mined References (13)

PMID Year Title