Property Summary

NCBI Gene PubMed Count 32
PubMed Score 23.95
PubTator Score 20.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.800 2.0e-02
astrocytic glioma -1.800 2.3e-03
atypical teratoid / rhabdoid tumor -2.200 2.7e-02
ependymoma -2.700 1.3e-03
glioblastoma -1.500 1.1e-02
group 4 medulloblastoma -3.600 3.6e-05
lung carcinoma 1.500 5.4e-10
medulloblastoma, large-cell -3.600 2.3e-03
oligodendroglioma -2.200 1.7e-02

Gene RIF (27)

AA Sequence

MGKVGAGGGSQARLSALLAGAGLLILCAPGVCGGGSCCPSPHPSSAPRSASTPRGFSHQGRPGRAPATPL      1 - 70
PLVVRPLFSVAPGDRALSLERARGTGASMAVAARSGRRRRSGADQEKAERGEGASRSPRGVLRDGGQQEP     71 - 140
GTRERDPDKATRFRMEELRLTSTTFALTGDSAHNQAMVHWSGHNSSVILILTKLYDYNLGSITESSLWRS    141 - 210
TDYGTTYEKLNDKVGLKTILSYLYVCPTNKRKIMLLTDPEIESSLLISSDEGATYQKYRLNFYIQSLLFH    211 - 280
PKQEDWILAYSQDQKLYSSAEFGRRWQLIQEGVVPNRFYWSVMGSNKEPDLVHLEARTVDGHSHYLTCRM    281 - 350
QNCTEANRNQPFPGYIDPDSLIVQDHYVFVQLTSGGRPHYYVSYRRNAFAQMKLPKYALPKDMHVISTDE    351 - 420
NQVFAAVQEWNQNDTYNLYISDTRGVYFTLALENVQSSRGPEGNIMIDLYEVAGIKGMFLANKKIDNQVK    421 - 490
TFITYNKGRDWRLLQAPDTDLRGDPVHCLLPYCSLHLHLKVSENPYTSGIIASKDTAPSIIVASGNIGSE    491 - 560
LSDTDISMFVSSDAGNTWRQIFEEEHSVLYLDQGGVLVAMKHTSLPIRHLWLSFDEGRSWSKYSFTSIPL    561 - 630
FVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAEEDYRPWQLHSQGEACIMGAKRIYKK    631 - 700
RKSERKCMQGKYAGAMESEPCVCTEADFDCDYGYERHSNGQCLPAFWFNPSSLSKDCSLGQSYLNSTGYR    701 - 770
KVVSNNCTDGVREQYTAKPQKCPGKAPRGLRIVTADGKLTAEQGHNVTLMVQLEEGDVQRTLIQVDFGDG    771 - 840
IAVSYVNLSSMEDGIKHVYQNVGIFRVTVQVDNSLGSDSAVLYLHVTCPLEHVHLSLPFVTTKNKEVNAT    841 - 910
AVLWPSQVGTLTYVWWYGNNTEPLITLEGSISFRFTSEGMNTITVQVSAGNAILQDTKTIAVYEEFRSLR    911 - 980
LSFSPNLDDYNPDIPEWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRST    981 - 1050
DDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLTPTHSGSAMLMLLSVVFVGLAVFVIY   1051 - 1120
KFKRRVALPSPPSPSTQPGDSSLRLQRARHATPPSTPKRGSAGAQYAI                         1121 - 1168
//

Text Mined References (35)

PMID Year Title