Property Summary

NCBI Gene PubMed Count 30
Grant Count 14
R01 Count 13
Funding $1,415,530.49
PubMed Score 23.46
PubTator Score 20.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.800 0.002
posterior fossa group B ependymoma -3.300 0.000
oligodendroglioma -2.200 0.017
glioblastoma -2.400 0.007
medulloblastoma -4.000 0.000
atypical teratoid / rhabdoid tumor -2.200 0.027
medulloblastoma, large-cell -3.600 0.002
adult high grade glioma -1.800 0.020
lung carcinoma 1.500 0.000

Gene RIF (25)

PMID Text
24128306 The propeptide region of sorCS1 contains two separate sites for binding to sortilin. One of these sites is removed from human sorCS1 during processing.
23780848 Data identified associations between single nucleotide polymorphisms in SORCS1 and renal function in large cohorts of European and African ancestry.
23700427 Genetic variation of the rs10884402 and rs950809 in intron 1 of SORCS1 is associated with late onset Alzheimer disease in the Chinese Han population.
23279143 The genetic link between AD[Alzheimer's disease]and SORCS1 gene variations are influenced by ethnic background, sex and whether an individual has type 2 diabetes mellitus
23055476 [review] Emerging data from a rapidly growing area of research implicates the Vps10 family of receptors and the retromer in physiological intracellular trafficking by neurotrophins and pathogenesis of neurodegeneration.
22353753 Our data suggested that SORCS1 was in interaction with APOE in the development of late-onset Alzheimer's disease in a Northern Han Chinese population
22046233 suggest that genetic variation in SORCS1 is associated with memory performance
21294870 the 4 recently reported SNPs,located near BNC2, SORCS1, GSC and WDR72 loci, affecting glycemic control in type 1 diabetes had no apparent effect on HbA1c in type 2 diabetes; but, for SORCS1 SNP, findings do not rule out possible relationship with HbA1c
20881129 Dysfunction of SorCS1 may contribute to both the amyloid precursor protein/amyloidbeta disturbance underlying Alzheimer disease and the insulin/glucose disturbance underlying diabetes mellitus.
20677014 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGKVGAGGGSQARLSALLAGAGLLILCAPGVCGGGSCCPSPHPSSAPRSASTPRGFSHQGRPGRAPATPL      1 - 70
PLVVRPLFSVAPGDRALSLERARGTGASMAVAARSGRRRRSGADQEKAERGEGASRSPRGVLRDGGQQEP     71 - 140
GTRERDPDKATRFRMEELRLTSTTFALTGDSAHNQAMVHWSGHNSSVILILTKLYDYNLGSITESSLWRS    141 - 210
TDYGTTYEKLNDKVGLKTILSYLYVCPTNKRKIMLLTDPEIESSLLISSDEGATYQKYRLNFYIQSLLFH    211 - 280
PKQEDWILAYSQDQKLYSSAEFGRRWQLIQEGVVPNRFYWSVMGSNKEPDLVHLEARTVDGHSHYLTCRM    281 - 350
QNCTEANRNQPFPGYIDPDSLIVQDHYVFVQLTSGGRPHYYVSYRRNAFAQMKLPKYALPKDMHVISTDE    351 - 420
NQVFAAVQEWNQNDTYNLYISDTRGVYFTLALENVQSSRGPEGNIMIDLYEVAGIKGMFLANKKIDNQVK    421 - 490
TFITYNKGRDWRLLQAPDTDLRGDPVHCLLPYCSLHLHLKVSENPYTSGIIASKDTAPSIIVASGNIGSE    491 - 560
LSDTDISMFVSSDAGNTWRQIFEEEHSVLYLDQGGVLVAMKHTSLPIRHLWLSFDEGRSWSKYSFTSIPL    561 - 630
FVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAEEDYRPWQLHSQGEACIMGAKRIYKK    631 - 700
RKSERKCMQGKYAGAMESEPCVCTEADFDCDYGYERHSNGQCLPAFWFNPSSLSKDCSLGQSYLNSTGYR    701 - 770
KVVSNNCTDGVREQYTAKPQKCPGKAPRGLRIVTADGKLTAEQGHNVTLMVQLEEGDVQRTLIQVDFGDG    771 - 840
IAVSYVNLSSMEDGIKHVYQNVGIFRVTVQVDNSLGSDSAVLYLHVTCPLEHVHLSLPFVTTKNKEVNAT    841 - 910
AVLWPSQVGTLTYVWWYGNNTEPLITLEGSISFRFTSEGMNTITVQVSAGNAILQDTKTIAVYEEFRSLR    911 - 980
LSFSPNLDDYNPDIPEWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRST    981 - 1050
DDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLTPTHSGSAMLMLLSVVFVGLAVFVIY   1051 - 1120
KFKRRVALPSPPSPSTQPGDSSLRLQRARHATPPSTPKRGSAGAQYAI                         1121 - 1168
//

Text Mined References (33)

PMID Year Title
24128306 2014 Human sorCS1 binds sortilin and hampers its cellular functions.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23780848 2013 SORCS1 contributes to the development of renal disease in rats and humans.
23700427 2013 The genetic variation of SORCS1 is associated with late-onset Alzheimer's disease in Chinese Han population.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
23279143 2012 Sortilin-related VPS10 domain containing receptor 1 and Alzheimer's disease-associated allelic variations preferentially exist in female or type 2 diabetes mellitus patients in southern Han Chinese.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23055476 2012 Vps10 family proteins and the retromer complex in aging-related neurodegeneration and diabetes.
22353753 2012 SORCS1 and APOE polymorphisms interact to confer risk for late-onset Alzheimer's disease in a Northern Han Chinese population.
22046233 2011 Impact of genetic variation in SORCS1 on memory retention.
More...