Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.58
PubTator Score 5.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q8WXX5 B2RMW6 HDJC9
Symbols JDD1
SB73
HDJC9

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLS      1 - 70
DREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGD     71 - 140
MDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLD    141 - 210
EGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK                        211 - 260
//

Text Mined References (17)

PMID Year Title