Property Summary

NCBI Gene PubMed Count 42
PubMed Score 21.06
PubTator Score 64.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Abortion, Threatened 1 0.0 0.0
Disease Target Count
Threatened abortion 1
Disease Target Count P-value
ependymoma 4679 5.5e-06
group 3 medulloblastoma 4104 2.5e-03
ovarian cancer 8520 3.1e-03
primary Sjogren syndrome 735 7.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.100 5.5e-06
group 3 medulloblastoma 1.600 2.5e-03
ovarian cancer 1.200 3.1e-03
primary Sjogren syndrome 1.100 7.9e-03

Gene RIF (24)

AA Sequence

MSRKISKESKKVNISSSLESEDISLETTVPTDDISSSEEREGKVRITRQLIERKELLHNIQLLKIELSQK      1 - 70
TMMIDNLKVDYLTKIEELEEKLNDALHQKQLLTLRLDNQLAFQQKDASKYQELMKQEMETILLRQKQLEE     71 - 140
TNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAE    141 - 210
ELSTNKNQLKQLTETYEEDRKNYSEVQIRCQRLALELADTKQLIQQGDYRQENYDKVKSERDALEQEVIE    211 - 280
LRRKHEILEASHMIQTKERSELSKEVVTLEQTVTLLQKDKEYLNRQNMELSVRCAHEEDRLERLQAQLEE    281 - 350
SKKAREEMYEKYVASRDHYKTEYENKLHDELEQIRLKTNQEIDQLRNASREMYERENRNLREARDNAVAE    351 - 420
KERAVMAEKDALEKHDQLLDRYRELQLSTESKVTEFLHQSKLKSFESERVQLLQEETARNLTQCQLECEK    421 - 490
YQKKLEVLTKEFYSLQASSEKRITELQAQNSEHQARLDIYEKLEKELDEIIMQTAEIENEDEAERVLFSY    491 - 560
GYGANVPTTAKRRLKQSVHLARRVLQLEKQNSLILKDLEHRKDQVTQLSQELDRANSLLNQTQQPYRYLI    561 - 630
ESVRQRDSKIDSLTESIAQLEKDVSNLNKEKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHS    631 - 700
ENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKMKT                 701 - 757
//

Text Mined References (45)

PMID Year Title