Property Summary

NCBI Gene PubMed Count 36
PubMed Score 19.86
PubTator Score 64.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession Q8WXW3 O95664 Q6U9V2 Q6UG50 Q86V07 Q96SF4 PIBF
Symbols PIBF
CEP90
C13orf24

Gene

Gene RIF (20)

PMID Text
26634256 These data show that exposure to an allogeneic stimulus is not needed to cause a marked rise in PIBF, merely progesterone alone is sufficient.
25818991 Maternal serum progesterone-induced blocking factor (PIBF) in the prediction of preterm birth.
25218441 Progesterone-induced blocking factor is hormonally regulated in human astrocytoma cells, and increases their growth through the IL-4R/JAK1/STAT6 pathway
24474429 progesterone-induced blocking factor is intracellularly expressed by the cultured cells from Glioblastoma
24325791 reduced expression during late pregnancy and resorption
24225150 decreased kisspeptin and PIBF expressions in trophoblasts and deciduas are associated with recurrent spontaneous abortion
23807209 Data indicate that silencing of progesterone-induced blocking factor (PIBF) increased invasiveness as well as MMP-2,-9 secretion of HTR8/SVneo trophoblast, and decreased those of HT-1080 cells.
23110211 CEP90 physically interacts with PCM-1 at centriolar satellites, and this interaction is essential for centrosomal accumulation of the centriolar satellites and eventually for primary cilia formation.
22172828 Suggest that urinary PIBF levels may predict graft rejection in transplant recipients.
22032897 increased serum levels after dydrogesterone supplementation in women with threatened preterm delivery; positive correlation with the length of gestation
More...

AA Sequence

MSRKISKESKKVNISSSLESEDISLETTVPTDDISSSEEREGKVRITRQLIERKELLHNIQLLKIELSQK      1 - 70
TMMIDNLKVDYLTKIEELEEKLNDALHQKQLLTLRLDNQLAFQQKDASKYQELMKQEMETILLRQKQLEE     71 - 140
TNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAE    141 - 210
ELSTNKNQLKQLTETYEEDRKNYSEVQIRCQRLALELADTKQLIQQGDYRQENYDKVKSERDALEQEVIE    211 - 280
LRRKHEILEASHMIQTKERSELSKEVVTLEQTVTLLQKDKEYLNRQNMELSVRCAHEEDRLERLQAQLEE    281 - 350
SKKAREEMYEKYVASRDHYKTEYENKLHDELEQIRLKTNQEIDQLRNASREMYERENRNLREARDNAVAE    351 - 420
KERAVMAEKDALEKHDQLLDRYRELQLSTESKVTEFLHQSKLKSFESERVQLLQEETARNLTQCQLECEK    421 - 490
YQKKLEVLTKEFYSLQASSEKRITELQAQNSEHQARLDIYEKLEKELDEIIMQTAEIENEDEAERVLFSY    491 - 560
GYGANVPTTAKRRLKQSVHLARRVLQLEKQNSLILKDLEHRKDQVTQLSQELDRANSLLNQTQQPYRYLI    561 - 630
ESVRQRDSKIDSLTESIAQLEKDVSNLNKEKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHS    631 - 700
ENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKMKT                 701 - 757
//

Publication (40)

PMID Year Title
26634256 2016 Evidence that exposure to progesterone alone is a sufficient stimulus to cause a precipitous rise in the immunomodulatory protein the progesterone induced blocking factor (PIBF).
26297806 2015 Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication.
25818991 2015 Maternal serum progesterone-induced blocking factor (PIBF) in the prediction of preterm birth.
25218441 2014 Progesterone-induced blocking factor is hormonally regulated in human astrocytoma cells, and increases their growth through the IL-4R/JAK1/STAT6 pathway.
24474429 2014 Cells isolated from human glioblastoma multiforme express progesterone-induced blocking factor (PIBF).
24325791 2014 Progesterone induced blocking factor isoforms in normal and failed murine pregnancies.
24225150 2014 Expression of kisspeptin/GPR54 and PIBF/PR in the first trimester trophoblast and decidua of women with recurrent spontaneous abortion.
24165912 2013 Genome-wide association study identifies 8 novel loci associated with blood pressure responses to interventions in Han Chinese.
23807209 2013 Progesterone-induced blocking factor differentially regulates trophoblast and tumor invasion by altering matrix metalloproteinase activity.
23110211 2012 CEP90 is required for the assembly and centrosomal accumulation of centriolar satellites, which is essential for primary cilia formation.
More...