Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.64
PubTator Score 10.89

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 2.28142385434374E-5
osteosarcoma 7933 0.00101755555250372
inflammatory breast cancer 404 0.00949200396443718
subependymal giant cell astrocytoma 2287 0.0399079786635054
Disease Target Count Z-score Confidence
Ehlers-Danlos syndrome 42 3.906 2.0


  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.078 0.001
subependymal giant cell astrocytoma 2.571 0.040
lung adenocarcinoma 1.200 0.000
inflammatory breast cancer 1.200 0.009

Gene RIF (11)

25863161 Data indicate that ADAMTS2, 3 and 14 cleave the amino-propeptide of fibrillar collagens. [review]
25638164 Suggest the existence of an epigenetic field defect for cancerization disrupting the methylation patterns of several loci, including MGMT or ADAMTS14, that may lead to predictive biomarkers for colorectal cancer in African Americans.
24301791 No significant associations were observed in males. In conclusion, the nsSNP rs4747096 in ADAMTS14 was associated with knee OA in female Thai patients; therefore, the role of ADAMTS14 in OA seems to be gender-dependent.
23491141 Carriage of the ADAMTS14 rs4747096 GG variant appears to delay onset of the injury in Achilles tendon pathology.
22205175 ADAMTS-2, -3, and -13 expression, but not that of ADAMTS-14, are increased in plaques causing AMI compared those associated with stable angina.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378664 Observational study of gene-disease association. (HuGE Navigator)
18790654 findings implicate ADAMTS14 in osteoarthritis
16385451 Observational study of gene-disease association. (HuGE Navigator)
15913795 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

WTQTPTPVPEDKGQPGEDLRHPGTSLPAASPVT                                        1191 - 1223

Text Mined References (18)

PMID Year Title
25863161 The procollagen N-proteinases ADAMTS2, 3 and 14 in pathophysiology.
25638164 2015 Methylation of MGMT and ADAMTS14 in normal colon mucosa: biomarkers of a field defect for cancerization preferentially targeting elder African-Americans.
24301791 2013 ADAMTS14 gene polymorphism associated with knee osteoarthritis in Thai women.
23728906 2013 A genome-wide association study of sleep habits and insomnia.
23491141 2013 Polymorphic variation within the ADAMTS2, ADAMTS14, ADAMTS5, ADAM12 and TIMP2 genes and the risk of Achilles tendon pathology: a genetic association study.
22205175 2012 Expression of ADAMTS-2, -3, -13, and -14 in culprit coronary lesions in patients with acute myocardial infarction or stable angina.
21254220 2011 Propensity score-based nonparametric test revealing genetic variants underlying bipolar disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378664 2010 Analysis of multiple candidate genes in association with phenotypes of multiple sclerosis.
19851299 2010 Linkage and genome-wide association analysis of obesity-related phenotypes: association of weight with the MGAT1 gene.