Property Summary

NCBI Gene PubMed Count 32
PubMed Score 92.59
PubTator Score 48.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Hyperplasia 27 0.0 0.0
Myocardial Ischemia 169 0.0 0.0
Disease Target Count Z-score Confidence
Tick infestation 17 3.171 1.6

Gene RIF (25)

AA Sequence

MARYMLLLLLAVWVLTGELWPGAEARAAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAHEAMGDTFPDA      1 - 70
DADEDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPGVLRGSRDVLAGLSSSCCKWGCSKSEISS     71 - 140
LC                                                                        141 - 142
//

Text Mined References (33)

PMID Year Title