Property Summary

NCBI Gene PubMed Count 27
Grant Count 2
Funding $40,460
PubMed Score 88.58
PubTator Score 48.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (20)

PMID Text
26272327 Serum concentrations of relaxin showed a positive association to duration of gestation among women with miscarriage but no association to duration of gestation among women with spontaneous onset of labour.
24988606 Review of research depicts the connection of relaxin-3 with phenomena such as feeding behavior, spatial memory, sleep/wake cycle or modulation of pituitary gland hormone secretion.
24802387 Mutant relaxin-3 shows a significant decrease in receptor-activation potency towards RXFP4.
24641548 we demonstrated distinct patterns of signalling for H3 and H2 relaxin and R3(BDelta23-27)R/I5 at the RXFP3 receptor
24615237 Glu141 and Asp145 of the RXFP3 interact with the highly conserved arginine residues of relaxin-3.
23994775 Relaxin-2 or relaxin-3 levels are not related to component traits in patients with diabetes.
23018057 metabolic syndrome is associated with increased serum relaxin-3 levels in women
21693186 [review] Relaxin-3 (RXF3P) is expressed within GABA neurons of the brainstem including an area known as the nucleus incertus; ascending relaxin-3 projections innervate a broad range of RXFP3-rich forebrain areas.
21229994 H3 relaxin exerts antifibrotic actions via RXFP1 receptor
20023247 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MARYMLLLLLAVWVLTGELWPGAEARAAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAHEAMGDTFPDA      1 - 70
DADEDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPGVLRGSRDVLAGLSSSCCKWGCSKSEISS     71 - 140
LC                                                                        141 - 142
//

Text Mined References (28)

PMID Year Title
26272327 2015 Physical fitness, serum relaxin and duration of gestation.
24988606 2014 [Relaxin-3 and relaxin family peptide receptors--from structure to functions of a newly discovered mammalian brain system].
24802387 2014 The electrostatic interactions of relaxin-3 with receptor RXFP4 and the influence of its B-chain C-terminal conformation.
24641548 2014 Signalling profiles of H3 relaxin, H2 relaxin and R3(B?23-27)R/I5 acting at the relaxin family peptide receptor 3 (RXFP3).
24615237 2014 The highly conserved negatively charged Glu141 and Asp145 of the G-protein-coupled receptor RXFP3 interact with the highly conserved positively charged arginine residues of relaxin-3.
23994775 2013 The plasma levels of relaxin-2 and relaxin-3 in patients with diabetes.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23018057 2013 Relaxin-3 is associated with metabolic syndrome and its component traits in women.
21693186 2011 Relaxin-3 systems in the brain--the first 10 years.
21229994 2011 H3 relaxin demonstrates antifibrotic properties via the RXFP1 receptor.
More...