Property Summary

NCBI Gene PubMed Count 25
Grant Count 12
R01 Count 10
Funding $1,985,235.25
PubMed Score 43.47
PubTator Score 30.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
group 3 medulloblastoma 2.000 0.005
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.400 0.000
adult high grade glioma -1.100 0.022
aldosterone-producing adenoma -1.209 0.015
psoriasis -1.100 0.000
spina bifida -1.470 0.042
Pick disease -1.200 0.000
ovarian cancer 2.300 0.000

Gene RIF (5)

PMID Text
22416126 The crystal structure of the heterodimer of the multidomain conserved region of the Drosophila behavior/human splicing proteins, PSPC1 and NONO, is described.
22174317 HIV-1 Rev interacting protein, paraspeckle protein 1 (PSPC1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PSPC1 is increased by RRE
22102035 crystal of PSPC1-NONO contained one heterodimer in the asymmetric unit and diffracted to 1.9 A resolution using synchrotron radiation
21532345 downregulated were the a protein coding gene PSPC1 in breast and ovarian cancer cells
16148043 We map the domain within PSP1 that is mediating this interaction and show it is required for the correct localization of PSP1 to paraspeckles. This interaction is necessary but not sufficient for paraspeckle targeting by PSP1

AA Sequence

MMLRGNLKQVRIEKNPARLRALESAVGESEPAAAAAMALALAGEPAPPAPAPPEDHPDEEMGFTIDIKSF      1 - 70
LKPGEKTYTQRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDRGFGFIRLESRTLAEIAKAELDGT     71 - 140
ILKSRPLRIRFATHGAALTVKNLSPVVSNELLEQAFSQFGPVEKAVVVVDDRGRATGKGFVEFAAKPPAR    141 - 210
KALERCGDGAFLLTTTPRPVIVEPMEQFDDEDGLPEKLMQKTQQYHKEREQPPRFAQPGTFEFEYASRWK    211 - 280
ALDEMEKQQREQVDRNIREAKEKLEAEMEAARHEHQLMLMRQDLMRRQEELRRLEELRNQELQKRKQIQL    281 - 350
RHEEEHRRREEEMIRHREQEELRRQQEGFKPNYMENREQEMRMGDMGPRGAINMGDAFSPAPAGNQGPPP    351 - 420
MMGMNMNNRATIPGPPMGPGPAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQA    421 - 490
PMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY                                         491 - 523
//

Publication (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22416126 2012 Structure of the heterodimer of human NONO and paraspeckle protein component 1 and analysis of its role in subnuclear body formation.
22102035 2011 Crystallization of a paraspeckle protein PSPC1-NONO heterodimer.
21532345 LSINCT5 is over expressed in breast and ovarian cancer and affects cellular proliferation.
21269460 2011 Initial characterization of the human central proteome.
More...