Property Summary

NCBI Gene PubMed Count 31
PubMed Score 48.33
PubTator Score 30.78

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 2.2e-02
aldosterone-producing adenoma -1.209 1.5e-02
atypical teratoid / rhabdoid tumor -1.200 4.9e-04
glioblastoma -1.400 3.2e-05
group 3 medulloblastoma 2.000 5.0e-03
malignant mesothelioma 1.300 4.2e-07
ovarian cancer 2.300 3.0e-05
Pick disease -1.200 2.2e-05
psoriasis -1.100 6.3e-12
spina bifida -1.470 4.2e-02

Gene RIF (5)

AA Sequence

MMLRGNLKQVRIEKNPARLRALESAVGESEPAAAAAMALALAGEPAPPAPAPPEDHPDEEMGFTIDIKSF      1 - 70
LKPGEKTYTQRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDRGFGFIRLESRTLAEIAKAELDGT     71 - 140
ILKSRPLRIRFATHGAALTVKNLSPVVSNELLEQAFSQFGPVEKAVVVVDDRGRATGKGFVEFAAKPPAR    141 - 210
KALERCGDGAFLLTTTPRPVIVEPMEQFDDEDGLPEKLMQKTQQYHKEREQPPRFAQPGTFEFEYASRWK    211 - 280
ALDEMEKQQREQVDRNIREAKEKLEAEMEAARHEHQLMLMRQDLMRRQEELRRLEELRNQELQKRKQIQL    281 - 350
RHEEEHRRREEEMIRHREQEELRRQQEGFKPNYMENREQEMRMGDMGPRGAINMGDAFSPAPAGNQGPPP    351 - 420
MMGMNMNNRATIPGPPMGPGPAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQA    421 - 490
PMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY                                         491 - 523
//

Text Mined References (41)

PMID Year Title