Property Summary

NCBI Gene PubMed Count 51
Grant Count 66
R01 Count 47
Funding $5,155,892.67
PubMed Score 40.90
PubTator Score 34.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene

PDB

4IGK   4NB3  

Gene RIF (19)

PMID Text
24990965 ATRIP SUMOylation promotes ATR activation by providing a unique type of protein glue that boosts multiple protein interactions along the ATR pathway
24073851 Data on crystal structure of BRCA1 binding with phosphopeptides suggest that C-terminal domain of BRCA1 interacts with ATRIP and BAAT1 with preferences for specific side chains; in ATRIP, phospho-Ser239 and Phe242 are the main interacting residues.
23454212 Data indicate that ATRIP is a direct target gene of HIF-1, and the increased ATRIP then activates the ATR signaling pathway under hypoxia.
23345434 as an ATR-associated kinase, Nek1 enhances the stability and activity of ATR-ATRIP before DNA damage, priming ATR-ATRIP for a robust DNA damage response
23144622 our analysis exposes an overlapping clinical manifestation between the disorders but allows an expanded spectrum of clinical features for ATR-ATRIP Seckel Syndrome to be defined
20861269 ATRIP may function outside the context of the canonical ATR damage signaling pathway during HSV-1 infection to participate in the viral life cycle.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
17638878 ATRIP is a CDK2 substrate, and CDK2-dependent phosphorylation of S224 regulates the ability of ATR-ATRIP to promote cell cycle arrest in response to DNA damage
More...

AA Sequence

MAGTSAPGSKRRSEPPAPRPGPPPGTGHPPSKRARGFSAAAAPDPDDPFGAHGDFTADDLEELDTLASQA      1 - 70
LSQCPAAARDVSSDHKVHRLLDGMSKNPSGKNRETVPIKDNFELEVLQAQYKELKEKMKVMEEEVLIKNG     71 - 140
EIKILRDSLHQTESVLEEQRRSHFLLEQEKTQALSDKEKEFSKKLQSLQSELQFKDAEMNELRTKLQTSE    141 - 210
RANKLAAPSVSHVSPRKNPSVVIKPEACSPQFGKTSFPTKESFSANMSLPHPCQTESGYKPLVGREDSKP    211 - 280
HSLRGDSIKQEEAQKSFVDSWRQRSNTQGSILINLLLKQPLIPGSSLSLCHLLSSSSESPAGTPLQPPGF    281 - 350
GSTLAGMSGLRTTGSYDGSFSLSALREAQNLAFTGLNLVARNECSRDGDPAEGGRRAFPLCQLPGAVHFL    351 - 420
PLVQFFIGLHCQALQDLAAAKRSGAPGDSPTHSSCVSSGVETNPEDSVCILEGFSVTALSILQHLVCHSG    421 - 490
AVVSLLLSGVGADSAAGEGNRSLVHRLSDGDMTSALRGVADDQGQHPLLKMLLHLLAFSSAATGHLQASV    491 - 560
LTQCLKVLVKLAENTSCDFLPRFQCVFQVLPKCLSPETPLPSVLLAVELLSLLADHDQLAPQLCSHSEGC    561 - 630
LLLLLYMYITSRPDRVALETQWLQLEQEVVWLLAKLGVQSPLPPVTGSNCQCNVEVVRALTVMLHRQWLT    631 - 700
VRRAGGPPRTDQQRRTVRCLRDTVLLLHGLSQKDKLFMMHCVEVLHQFDQVMPGVSMLIRGLPDVTDCEE    701 - 770
AALDDLCAAETDVEDPEVECG                                                     771 - 791
//

Publication (59)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24990965 2014 SUMOylation of ATRIP potentiates DNA damage signaling by boosting multiple protein interactions in the ATR pathway.
24332808 2014 PRP19 transforms into a sensor of RPA-ssDNA after DNA damage and drives ATR activation via a ubiquitin-mediated circuitry.
24073851 2013 Structural basis for the BRCA1 BRCT interaction with the proteins ATRIP and BAAT1.
23454212 2013 HIF1-regulated ATRIP expression is required for hypoxia induced ATR activation.
23345434 2013 Nek1 kinase associates with ATR-ATRIP and primes ATR for efficient DNA damage signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23144622 2012 Identification of the first ATRIP-deficient patient and novel mutations in ATR define a clinical spectrum for ATR-ATRIP Seckel Syndrome.
22258451 2012 ATR-ATRIP kinase complex triggers activation of the Fanconi anemia DNA repair pathway.
22210626 2012 Genome-wide association study in multiple human prion diseases suggests genetic risk factors additional to PRNP.
More...