Property Summary

NCBI Gene PubMed Count 24
Grant Count 5
Funding $528,876.46
PubMed Score 33.63
PubTator Score 29.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
oligodendroglioma 1.100 0.043
glioblastoma -3.200 0.003
posterior fossa group A ependymoma -2.600 0.000
atypical teratoid / rhabdoid tumor -5.900 0.000
medulloblastoma -1.200 0.005
medulloblastoma, large-cell -1.400 0.000
primitive neuroectodermal tumor -1.200 0.001
lung cancer 2.500 0.000
colon cancer -1.100 0.000
Parkinson's disease -1.300 0.013
pediatric high grade glioma -2.000 0.019
subependymal giant cell astrocytoma -2.694 0.019
lung carcinoma 6.100 0.000
Alzheimer's disease -1.500 0.015
Pick disease -1.600 0.000
progressive supranuclear palsy -1.300 0.014
psoriasis -1.100 0.000

 GO Function (1)

 GO Process (1)

Gene RIF (10)

PMID Text
24882622 HBXIP facilitates the proliferation of hepatoma cells by up-regulating SCG3 via E2F1 and miR-509-3p modulation.
22998035 SCG3 is essential in the process and targeting of neuropeptides and neurotrophins, its participation in the pathological progression of Alzheimer's disease may be suggested
22987761 SCG3 may be involved in apoptosis signal transduction as a caspase substrate.It may be a pivotal component of the neuroendocrine pathway & play an important role in neuronal communication & neurotransmitter release.
21796137 Our data suggest that genetic variations in the FTO, SCG3 and MTMR9 genes independently influence the risk of metabolic syndrome.
21046454 This short review deals with investigations in neuroendocrine tumors (NETs) with antibodies against defined epitopes of chromogranins (Cgs) A and B and secretogranins (Sgs) II and III.
20550951 SgIII was expressed in 41 of 47 neuroendocrine tumours. The expression of SgIII agreed well with that of CgA, CgB and SgII, with exceptions of phaeochromocytomas and parathyroid adenomas.
19150442 these data suggest that SgIII, DMT-1 and HNP-1 are implicated in cell-mediated LDL oxidation.
18448176 Secretogranins III assays failed to detect increased concentrations in any of the patients with neuroendocrine tumours.
17200173 Observational study of gene-disease association. (HuGE Navigator)
17200173 Genetic variations in the SCG3 gene may influence the risk of obesity through possible regulation of hypothalamic neuropeptide secretion.

AA Sequence

MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYS      1 - 70
FVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQ     71 - 140
LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEE    141 - 210
DPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNF    211 - 280
YALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDN    281 - 350
ISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLK    351 - 420
KHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL                          421 - 468
//

Publication (27)

PMID Year Title
24882622 2014 The oncoprotein HBXIP up-regulates SCG3 through modulating E2F1 and miR-509-3p in hepatoma cells.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
22998035 2013 Secretory sorting receptors carboxypeptidase E and secretogranin III in amyloid ?-associated neural degeneration in Alzheimer's disease.
22987761 2012 Dysregulated expression of secretogranin III is involved in neurotoxin-induced dopaminergic neuron apoptosis.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21796137 2011 Association of variations in the FTO, SCG3 and MTMR9 genes with metabolic syndrome in a Japanese population.
21046454 2010 Immunohistochemical and biochemical studies with region-specific antibodies to chromogranins A and B and secretogranins II and III in neuroendocrine tumors.
20550951 2010 Secretogranin III in human neuroendocrine tumours: a comparative immunohistochemical study with chromogranins A and B and secretogranin II.
20159242 2010 Genome-wide association study of asthma identifies RAD50-IL13 and HLA-DR/DQ regions.
19150442 2009 LDL oxidation by THP-1 monocytes: implication of HNP-1, SgIII and DMT-1.
More...