Property Summary

NCBI Gene PubMed Count 24
PubMed Score 42.06
PubTator Score 29.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.000 3.0e-03
Alzheimer's disease -1.500 1.5e-02
atypical teratoid / rhabdoid tumor -5.900 2.4e-10
colon cancer -1.100 3.4e-04
ependymoma -2.300 5.0e-05
glioblastoma -1.400 2.5e-02
lung cancer 1.100 9.1e-03
lung carcinoma 6.100 2.9e-78
medulloblastoma -1.200 5.0e-03
medulloblastoma, large-cell -1.400 3.2e-05
oligodendroglioma 1.100 4.3e-02
Parkinson's disease -1.300 1.3e-02
Pick disease -1.600 3.2e-04
primitive neuroectodermal tumor -1.200 1.0e-03
progressive supranuclear palsy -1.300 1.4e-02
psoriasis -1.100 4.0e-18
subependymal giant cell astrocytoma -2.694 1.9e-02

 GO Function (1)

 MGI Phenotype (1)

Protein-protein Interaction (4)

Gene RIF (10)

AA Sequence

MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYS      1 - 70
FVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQ     71 - 140
LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEE    141 - 210
DPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNF    211 - 280
YALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDN    281 - 350
ISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLK    351 - 420
KHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL                          421 - 468
//

Text Mined References (27)

PMID Year Title