Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.77
PubTator Score 7.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.229 2.2e-05
adrenocortical carcinoma 1.115 8.4e-03
adult high grade glioma 1.400 1.4e-02
astrocytic glioma 1.100 4.5e-02
atypical teratoid / rhabdoid tumor -1.600 3.9e-04
Breast cancer -1.900 4.5e-15
ependymoma 1.800 2.0e-02
glioblastoma 1.600 2.5e-03
head and neck cancer -1.100 6.3e-04
intraductal papillary-mucinous adenoma (... 1.200 3.6e-03
intraductal papillary-mucinous carcinoma... 1.200 1.4e-02
intraductal papillary-mucinous neoplasm ... 1.500 1.3e-02
medulloblastoma, large-cell -1.300 3.9e-04
Multiple myeloma 1.267 8.8e-04
osteosarcoma 1.254 5.8e-03
ovarian cancer -1.300 1.0e-04
Pick disease -1.300 3.9e-04
primitive neuroectodermal tumor 1.100 7.2e-03
progressive supranuclear palsy -1.100 2.5e-02
psoriasis 1.200 3.0e-07
tuberculosis 1.100 1.8e-04

Gene RIF (4)

AA Sequence

MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYV      1 - 70
GNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHS     71 - 140
NNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPESGKSNERKGGRSRSHTRSKSRSSSKSHSRR    141 - 210
KRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSHSRDKRKDTREKIKEKERVKEKDRE    211 - 280
KEREREKEREKEKERGKNKDRDKEREKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKE    281 - 350
IDEKRKKDKKSRTPPRSYNASRRSRSSSRERRRRRSRSSSRSPRTSKTIKRKSSRSPSPRSRNKKDKKRE    351 - 420
KERDHISERRERERSTSMRKSSNDRDGKEKLEKNSTSLKEKEHNKEPDSSVSKEVDDKDAPRTEENKIQH    421 - 490
NGNCQLNEENLSTKTEAV                                                        491 - 508
//

Text Mined References (21)

PMID Year Title