Property Summary

NCBI Gene PubMed Count 18
Grant Count 4
R01 Count 4
Funding $271,800
PubMed Score 3.77
PubTator Score 7.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WXA9 A4FTW3 Q2M1J0 Q86X37
Symbols SFRS12
SRrp86
SRrp508

Gene

Gene RIF (4)

PMID Text
20400856 From among the 500 splicing events exhibiting altered splicing under these conditions, the splicing of c-Jun and IkappaBbeta were validated as being regulated by SRrp86 resulting in altered regulation of their downstream targets.
15456940 p18SRP is a lysine-rich zinc finger domain-containing protein that interacts with the serine-arginine-rich splicing regulatory protein SRrp86; it is downregulated in brain of Alzheimer disease patients.
12183448 the unique glutamic acid-lysine domain of SRrp86 plays a modulatory role controlling serine-arginine domain function
11991645 SRrp86 can activate SRp20 and repress SC35 in a dose-dependent manner both in vitro and in vivo

AA Sequence

MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYV      1 - 70
GNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHS     71 - 140
NNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPESGKSNERKGGRSRSHTRSKSRSSSKSHSRR    141 - 210
KRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSHSRDKRKDTREKIKEKERVKEKDRE    211 - 280
KEREREKEREKEKERGKNKDRDKEREKDREKDKEKDREREREKEHEKDRDKEKEKEQDKEKEREKDRSKE    281 - 350
IDEKRKKDKKSRTPPRSYNASRRSRSSSRERRRRRSRSSSRSPRTSKTIKRKSSRSPSPRSRNKKDKKRE    351 - 420
KERDHISERRERERSTSMRKSSNDRDGKEKLEKNSTSLKEKEHNKEPDSSVSKEVDDKDAPRTEENKIQH    421 - 490
NGNCQLNEENLSTKTEAV                                                        491 - 508
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
20400856 Analysis of SRrp86-regulated alternative splicing: control of c-Jun and I?B? activity.
19951526 2009 [Changes of gene expression profile in homoharringtonine-induced leukemia multi-drug resistant cell line K562/HHT].
19309015 2009 2-D PAGE-based comparison of proteasome inhibitor bortezomib in sensitive and resistant mantle cell lymphoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...