Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.40
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 0.9

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -2.000 3.3e-02
Breast cancer -1.300 9.8e-33
group 3 medulloblastoma 1.800 4.3e-05
oligodendroglioma -1.900 3.6e-02
osteosarcoma -4.939 3.3e-14
posterior fossa group A ependymoma -1.100 2.5e-12

Gene RIF (1)

AA Sequence

MGGDCLGLGGSRGRHGNAPPPLFRPVPARVLRHSGRGLEVPRRPGARTGPATKDPTAVERANLLNMAKLS      1 - 70
IKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKVRKSFLSYNKTIWGPLELVEKLYPEAEEIGAS     71 - 140
VRDLPGLKTPLGRARAWLRLALMQKKMADYLRCLIIQRDLLSEFYEYHALMMEEEGAVIVGLLVGLNVID    141 - 210
ANLCVKGEDLDSQVGVIDFSMYLKNEEDIGNKERNVQIAAILDQKNYVEELNRQLNSTVSSLHSRVDSLE    211 - 280
KSNTKLIEELAIAKNNIIKLQEENHQLRSENKLILMKTQQHLEVTKVDVETELQTYKHSRQGLDEMYNEA    281 - 350
RRQLRDESQLRQDVENELAVQVSMKHEIELAMKLLEKDIHEKQDTLIGLRQQLEEVKAINIEMYQKLQGS    351 - 420
EDGLKEKNEIIARLEEKTNKITAAMRQLEQRLQQAEKAQMEAEDEDEKYLQECLSKSDSLQKQISQKEKQ    421 - 490
LVQLETDLKIEKEWRQTLQEDLQKEKDALSHLRNETQQIISLKKEFLNLQDENQQLKKIYHEQEQALQEL    491 - 560
GNKLSESKLKIEDIKEANKALQGLVWLKDKEATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELPLP    561 - 630
SSPKPVRVCDSCHALLIQRCSSNLP                                                 631 - 655
//

Text Mined References (12)

PMID Year Title