Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.15
PubTator Score 3.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Umbilical hernia 18 3.974 2.0

Expression

Gene RIF (3)

PMID Text
17884839 These results suggest that insulin-like growth factor-binding protein-related protein 1 may play a role in decidualization of human endometrial stromal cells.
17634530 Expression of IGFBPL1 is regulated by aberrant hypermethylation in breast cancer, implying that inactivation of these genes is involved in the pathogenesis of this malignancy.
15845387 IGFBP-RP4 may be a novel putative tumor suppressor protein.

AA Sequence

MPRLSLLLPLLLLLLLPLLPPLSPSLGIRDVGGRRPKCGPCRPEGCPAPAPCPAPGISALDECGCCARCL      1 - 70
GAEGASCGGRAGGRCGPGLVCASQAAGAAPEGTGLCVCAQRGTVCGSDGRSYPSVCALRLRARHTPRAHP     71 - 140
GHLHKARDGPCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVN    141 - 210
IAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVGEAESHSTVTVLDLSKYRSFHFPAPDDRM      211 - 278
//

Text Mined References (5)

PMID Year Title
17884839 2007 Involvement of insulin-like growth factor-binding protein-related protein 1 in decidualization of human endometrial stromal cells.
17634530 2007 Epigenetic inactivation implies independent functions for insulin-like growth factor binding protein (IGFBP)-related protein 1 and the related IGFBPL1 in inhibiting breast cancer phenotypes.
15845387 2005 Identification of a novel insulin-like growth factor binding protein gene homologue with tumor suppressor like properties.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.