Property Summary

NCBI Gene PubMed Count 8
Grant Count 5
R01 Count 5
Funding $417,366.6
PubMed Score 33.61
PubTator Score 2.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.969 0.000

Gene RIF (4)

PMID Text
25824785 Loss of heterozygosity of OIT3 gene on chromosome 10q is associated with pancreatic cancer.
18830570 The finding that LZP might act as a new partner of THP would provide novel insights into renal functions related to THP and LZP, such as the urothelial permeability barrier and the host defense against the adhesion of pathogens.
15589826 D8C, a novel domain present in LZP, mutates in familial juvenile hyperuricemia.
12939600 Liver-specific ZP domain-containing protein (LZP) is a liver-specific protein involved possibly in hepatocellular function and development. (liver-specific ZP domain-containing protein)

AA Sequence

MPPFLLLTCLFITGTSVSPVALDPCSAYISLNEPWRNTDHQLDESQGPPLCDNHVNGEWYHFTGMAGDAM      1 - 70
PTFCIPENHCGTHAPVWLNGSHPLEGDGIVQRQACASFNGNCCLWNTTVEVKACPGGYYVYRLTKPSVCF     71 - 140
HVYCGHFYDICDEDCHGSCSDTSECTCAPGTVLGPDRQTCFDENECEQNNGGCSEICVNLKNSYRCECGV    141 - 210
GRVLRSDGKTCEDVEGCHNNNGGCSHSCLGSEKGYQCECPRGLVLSEDNHTCQVPVLCKSNAIEVNIPRE    211 - 280
LVGGLELFLTNTSCRGVSNGTHVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDFIIRTSKL    281 - 350
LIPVTCEFPRLYTISEGYVPNLRNSPLEIMSRNHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGI    351 - 420
EPVVHVSGLESLVESCFATPTSKIDEVLKYYLIRDGCVSDDSVKQYTSRDHLAKHFQVPVFKFVGKDHKE    421 - 490
VFLHCRVLVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQGQTLTGGPIRIDWED                   491 - 545
//

Publication (10)

PMID Year Title
25824785 2015 Loss of heterozygosity at the calcium regulation gene locus on chromosome 10q in human pancreatic cancer.
25416956 2014 A proteome-scale map of the human interactome network.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18830570 2009 Liver-specific ZP domain-containing protein (LZP) as a new partner of Tamm-Horsfall protein harbors on renal tubules.
15589826 2004 Identification and characterization of D8C, a novel domain present in liver-specific LZP, uromodulin and glycoprotein 2, mutated in familial juvenile hyperuricaemic nephropathy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12939600 2003 A novel liver-specific zona pellucida domain containing protein that is expressed rarely in hepatocellular carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.